Akademie der Künste, Berlin

Name:
Akademie der Künste, Berlin

Kurzname:

Tr�gereinrichtung:

Strasse:
Chausseestraße 125

Postleitzahl:
10115

Ort:
Berlin

Postanschrift:

Telefon:
(030) 200571831

Telefax:
(030) 200571833

E-Mail:
bertoltbrechtarchiv@adk.de

Homepage:
www.adk.de

Leitung:
Dr. Erdmut Wizisla

Mitarbeiter(innen):
4

�ffnungszeiten:
nach Vereinbarung

Verkehrsverbindung:
Oranienburger Tor (U6); Tram M8, M12

Best�nde:
Das Bertolt-Brecht-Archiv umfasst den Nachlass des Schriftstellers und Regisseurs, ergänzt um ausgedehnte Sammlungen zu Werk und Rezeption. Es wurde am 1. Dezember 1956 von Helene Weigel, Brechts Witwe, gegründet. Seit 1978 ist das Helene-Weigel-Archiv zugeordnet. Im Bertolt-Brecht-Archiv werden heute (im Jahr 2008) ca. 500.000 Dokumente aufbewahrt, das Archiv gliedert sich in die Arbeitsbereiche Handschriften, Bibliothek, Fotoarchiv und Tonarchiv. Zu den Beständen gehören ca. 220.000 Werkhandschriften, Tagebücher und Briefe, Urkunden (darunter Arbeiten von Mitarbeiterinnen und Mitarbeitern Brechts, Freunden und Kollegen wie Walter Benjamin, Hanns Eisler, Karl Korsch, Elisabeth Hauptmann, Margarete Steffin, Ruth Berlau, Käthe Rülicke), die Modellbücher von Brechts Inszenierungen, Fotos, ca. 25 000 Bücher und andere Druckschriften, unter ihnen die wertvolle Nachlassbibliothek Brechts mit 4218 Bänden, ca. 100 000 Presseveröffentlichungen, Programmhefte, Theaterplakate, Inszenierungsfotos, Filme, Bild- und Tonträger, Grafik.

Findmittel:
Datenbanken, Findbücher, Findbuchmanuskripte und -karteien.

Ver�ffentlichungen:
Bestandsverzeichnis des literarischen Nachlasses, bearb. von Herta Ramthun, Berlin 1969-1973; 1898 - Bertolt Brecht - 1998. "und mein Werk ist der Abgesang des Jahrtausends". 22 Versuche, eine Arbeit zu beschreiben, zusammengestellt und kommentiert von Erdmut Wizisla (Ausstellungskatalog), Berlin 1998; Chausseestraße 125. Die Wohnungen von Bertolt Brecht und Helene Weigel in Berlin Mitte. Fotografiert von Sibylle Bergemann, Berlin 2000; Akademie-Fenster 3, "Unerbittlich das Richtige zeigend" Helene Weigel (1900-1971), herausgegeben von der Stiftung Archiv der Akademie der Künste, Berlin 2000 (Katalog zur Ausstellung "Unerbittlich das Richtige zeigend. Helene Weigel (1900-1971)) 21. April - 19. Mai 2000 in der Dresdner Bank am Pariser Platz, Berlin; Die Bibliothek Bertolt Brechts. Ein kommentiertes Verzeichnis. Hrsg. vom Bertolt-Brecht-Archiv, Akademie der Künste. Bearb. von Erdmut Wizisla, Helgrid Streidt und Heidrun Loeper, Frankfurt am Main 2007.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Akademischer Segler-Verein e.V. (ASV)

Name:
Akademischer Segler-Verein e.V. (ASV)

Kurzname:

Tr�gereinrichtung:

Strasse:
Scharfe Lanke 57/59/61

Postleitzahl:
13595

Ort:
Berlin

Postanschrift:
c/o Ivo Schuppe, Lilienthalstraße 28, 10965 Berlin

Telefon:
(030) 79705098

Telefax:
(030) 79705098

E-Mail:
archiv@asv-berlin.de

Homepage:
www.asv-berlin.de

Leitung:
Ivo Schuppe M.A.

Mitarbeiter(innen):
1 (ehrenamtlich)

�ffnungszeiten:
nach Vereinbarung

Verkehrsverbindung:

Best�nde:
Der Träger des ehrenamtlich geführten Archivs ist der Akademische Segler-Verein e.V. (ASV, gegründet 1886). Die Bestände umfassen vor allem vereinbezogenes Archivgut, das gleichzeitig den Beginn des (Hochsee-) Segelsports in Deutschland, das Segeln in Berlin sowie das studentische Leben dieser Segelverbindung widerspiegelt.

Das Archiv beinhaltet die vereinseigenen Publikationen (Jahresberichte, erschienen seit 1886, sowie Jubiläumshefte und weitere Publikationen) sowie die Unterlagen des Geschäftsbetriebs und des Vereinslebens. Daneben sind im sog. "Betzhold-Archiv" Unterlagen zu fast allen Mitgliedern des Vereins seit 1886 vorhanden, darunter eine Reihe wichtiger Persönlichkeiten des deutschen Segelsports und Schiffbaus. Das Fotoarchiv enthält Fotografien ab ca. 1890 (Vereinsschiffe, Vereinshäuser, akademisches Studentenleben etc.).

Findmittel:
Bestandskatalog

Ver�ffentlichungen:
Zweimal Atlantik und zurück. Walross III beim DCN AC-Kace 2002/2003, hrsg. vom ASV e.V., Berlin 2003.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

akg-images

Name:
akg-images

Kurzname:

Tr�gereinrichtung:

Strasse:
Teutonenstraße 22

Postleitzahl:
14129

Ort:
Berlin

Postanschrift:

Telefon:
(030) 804850

Telefax:
(030) 80485500

E-Mail:
info@akg.de

Homepage:
www.akg.de

Leitung:
Kathrin Goepel

Mitarbeiter(innen):
45

�ffnungszeiten:
Mo-Fr 8.00-19.00

Verkehrsverbindung:
Nikolassee (S1, 7)

Best�nde:
Historisches Universalbildarchiv mit über 10 Millionen Motiven. Kommerzieller Vertrieb für alle Medien, analog und digital. Schwerpunkte: Kunst, Geschichte, Fotografie von den Anfängen bis zur Gegenwart.

Findmittel:
Bilddatenbank mit umfangreicher Verschlagwortung und Thesaurus. Onlinesuche auf Homepage. Nutzung nur nach Voranmeldung und auf kommerzieller Basis.

Ver�ffentlichungen:

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Alice-Salomon-Archiv

Name:
Alice-Salomon-Archiv

Kurzname:

Tr�gereinrichtung:
Alice-Salomon-Fachhochschule für Sozialarbeit und Sozialpädagogik Berlin

Strasse:
c/o Pestalozzi-Fröbel-Haus, Haus 3, Karl-Schrader-Straße 7-8

Postleitzahl:
10781

Ort:
Berlin

Postanschrift:

Telefon:
(030) 21730277

Telefax:
(030) 21730188

E-Mail:
archiv@asfh-berlin.de

Homepage:
www.asfh-berlin.de/archiv

Leitung:
Adriane Feustel

Mitarbeiter(innen):
1

�ffnungszeiten:
Mo, Mi 10.00-13.00, Do 10.00-15.00, Besuch nur nach Voranmeldung

Verkehrsverbindung:
Eisenacher Straße (U7)

Best�nde:
Das Alice-Salomon-Archiv bildet zusammen mit dem Archiv des Pestalozzi-Fröbel-Hauses das Archiv- und Dokumentationszentrum für soziale und pädagogische Frauenarbeit. Aufgaben des Zentrums sind Sammlung, Erhalt und öffentliche Nutzbarmachung der historischen Quellen; Förderung des Austauschs zwischen Fachhochschulen, Universitäten und Fachschulen sowie Unterstützung von Forschungen. Das Alice-Salomon-Archiv ist hervorgegangen aus dem Verwaltungsmagazin der 1908 gegründeten Sozialen Frauenschule, die 1932 den Namen ihrer Gründerin, Alice Salomon, erhielt. Vorläufer der zweijährigen Schule waren 1899 begonnene Ausbildungskurse der "Mädchen- und Frauengruppen für soziale Hilfsarbeit". Die Alice-Salomon-Schule ist die älteste Soziale Schule in Deutschland, Wegbereiterin der Professionalisierung der Sozialen Arbeit. Sie war ein Zentrum der sozial und pädagogisch engagierten Frauenbewegung, außerdem Sitz der Deutschen Akademie für soziale und pädagogische Frauenarbeit (1925-1933), die Frauen für soziale Führungspositionen und Dozententätigkeiten qualifizierte und empirische Familienforschungen durchführte, ferner der Konferenz der Sozialen Frauenschulen Deutschlands (gegr. 1917) und des Internationalen Komitees der Sozialen Schulen (gegr. 1929).
Die Bestände im Einzelnen: Ausbildungsakten und -materialien der Sozialen Frauenschule 1900-1971 (einschließlich der Vorläufer- und Nachfolgeeinrichtungen), Akten der Konferenz der Sozialen Frauenschulen Deutschlands seit 1917; der Internationalen Vereinigung der Sozialen Schulen 1929-1935, Akten der Studierenden der Deutschen Akademie für pädagogische und soziale Frauenarbeit 1925-1934, Schülerinnenverzeichnisse und Nummernbücher der Schulen des Vereins Jugendheim Charlottenburg 1898-1934 (Leitung: Anna von Gierke), eine Fotosammlung, eine neu angelegte Sammlung der Schriften Alice Salomons sowie eine im Aufbau befindliche Sammlung von Briefen und unveröffentlichten Texten Alice Salomons.

Findmittel:
Findbuch, personenbezogene Datenbank; eine Datenbank für alle Bestände ist im Aufbau.

Ver�ffentlichungen:
A. Feustel, S. Sander: Das Archiv- und Dokumentationszentrum für soziale und pädagogische Frauenarbeit, in: Mitteilungen und Materialien. Zeitschrift für Museum und Bildung 56/2001, S. 67-71; A. Feustel: Das Alice-Salomon-Archiv in Berlin, in: Gender und Soziale Arbeit - Geschichte der Sozialarbeit in Europa (1900-1960), 2002; Sozialpädagogik und Geschlechterverhältnis 1900 und 2000. Dokumentation des Colloquiums zur Eröffnung des Archiv- und Dokumentationszentrums für soziale und pädagogische Frauenarbeit am 18. Mai 2000, hrsg. von A. Feustel, Berlin 2002.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Amtsgericht Tiergarten. Grundbucharchiv

Name:
Amtsgericht Tiergarten. Grundbucharchiv

Kurzname:

Tr�gereinrichtung:

Strasse:
Westhafenstraße 1

Postleitzahl:
13353

Ort:
Berlin

Postanschrift:

Telefon:
(030) 3433140

Telefax:
(030) 34331428

E-Mail:

Homepage:

Leitung:
Sabine Laars

Mitarbeiter(innen):
4

�ffnungszeiten:
Mo-Do 8.30-13.00, Do 15.00-17.00, Fr 8.30-12.00

Verkehrsverbindung:
Westhafen (S, U9)

Best�nde:
Das Archiv ist zuständig für die Einsichtnahmen in geschlossene Grundbücher und Vorbände von Grundakten über Liegenschaften im beigetretenen Teil Berlins. Teilauslagerung der Bezirke Biesdorf, Falkenberg, Hellersdorf, Hohenschönhausen, Kaulsdorf, Mahlsdorf, Malchow, Marzahn und Wartenberg zum Amtsgericht Hohenschönhausen.

Findmittel:

Ver�ffentlichungen:

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Archiv Demokratischer Sozialismus (ADS) bei der Rosa-Luxemburg-Stiftung

Name:
Archiv Demokratischer Sozialismus (ADS) bei der Rosa-Luxemburg-Stiftung

Kurzname:

Tr�gereinrichtung:

Strasse:
Franz-Mehring-Platz 1

Postleitzahl:
10243

Ort:
Berlin

Postanschrift:

Telefon:
(030) 44310-121, 44310-131, 44310-166

Telefax:
(030) 44310-222 oder 44310-185

E-Mail:
archiv@rosaluxemburgstiftung.de

Homepage:
www.rosaluxemburgstiftung.de

Leitung:
Dr. Jochen Weichold

Mitarbeiter(innen):
2

�ffnungszeiten:
Mo-Do 9.00-15.00, außerhalb dieser Öffnungszeiten nach Absprache. Um telefonische oder schriftliche Anmeldung wird gebeten.

Verkehrsverbindung:
Ostbahnhof (S); Weberwiese (U5); Franz-Mehring-Platz (Bus 240, 340, 347)

Best�nde:
Das ADS, das Mitte 1999 geschaffen wurde, hat die Aufgabe, Quellen zur Entwicklung der Partei des Demokratischen Sozialismus in Deutschland zu sammeln, zu erschließen, zu bewahren und der Öffentlichkeit zugänglich zu machen. Es gliedert seine Bestände in folgende sechs Abteilung: A) Bestände des Parteivorstandes des PDS. B) Bestände der Bundestagsfraktion der PDS, die Akten und andere Unterlagen der Fraktion bzw. Gruppe und der einzelnen Abgeordneten einschließlich der Zeit der frei gewählten Volkskammer der DDR des Jahres 1990 umfassen. Gegenwärtig verfügt das ADS über die Archivalien der PDS-Fraktion der 10. Wahlperiode der Volkskammer der DDR vom März bis zum Oktober 1990 und über Archivalien der PDS im Deutschen Bundestag von 1990 bis 2002 sowie über Akten und andere Unterlagen der PDS-Bundestagsabgeordneten aus der Zeit von 1990 bis 2002. C) Bestände der Landtagsfraktionen der PDS. D) Nachlässe, Teile von Nachlässen und Deposita. E) Sammlungen von Fotos, Plakaten, Flugblättern, Filmen, Videos, Tonaufnahmen, Zeitungsausschnitten, Aufklebern, gegenständlichen Quellen usw. F) Unterlagen der Rose-Luxemburg-Stiftung ("Stiftungsarchiv").

Findmittel:
Findbücher, Ablieferungsverzeichnisse; elektronische Recherche mittels AUGIAS-Archiv am PC im Benutzerraum des ADS möglich.

Ver�ffentlichungen:
Reihe "Findbücher": Findbücher/01. Bestand PDS-Fraktion in der Volkskammer der DDR (März bis Oktober 1990), Berlin 2000 (2., überarbeitete und erweiterte Neuauflage, Berlin 2003); Findbücher/02. Bestand Die PDS im Deutschen Bundestag (1990 bis 1994), Berlin 2001; Findbücher/03. Bestand Dr. Dagmar Enkelmann, MdB (1990 bis 1998), Berlin 2001; Findbücher/04. Bestand Dr. Hans Modrow, MdB (1990 bis 1994), Berlin 2001; Findbücher/05. Bestand Jürgen Demloff, MdV (März bis Oktober 1990), Berlin 2002; Findbücher/06. Bestand: Die PDS im Deutschen Bundestag (1994 bis 1998), Berlin 2003; Jochen Weichold: Archiv Demokratischer Sozialismus, in: Mitteilungen des Förderkreises Archive und Bibliotheken zur Geschichte der Arbeiterbewegung, Berlin, Nr. 21 vom März 2002, S. 2 f.; Jochen Weichold: Akten der PDS-Bundestagsabgeordneten und der Fraktion im Archiv Demokratischer Sozialismus (ADS) der Rosa-Luxemburg-Stiftung, in: Mitteilungen der Fachgruppe 6: Archivare an Archiven der Parlamente, der Politischen Parteien, Stiftungen und Verbände im Verband deutscher Archivarinnen und Archivare e.V., Nr. 28, Sankt Augustin 2003, S. 65 f.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Archiv der Akademie der Künste

Name:
Archiv der Akademie der Künste

Kurzname:

Tr�gereinrichtung:
Bundesrepublik Deutschland

Strasse:
Pariser Platz 4 (und weitere Standorte)

Postleitzahl:
10117

Ort:
Berlin

Postanschrift:

Telefon:
(030) 200571602

Telefax:
(030) 200571606

E-Mail:
archivdirektion@adk.de

Homepage:
www.adk.de

Leitung:
Dr. Wolfgang Trautwein

Mitarbeiter(innen):
60

�ffnungszeiten:
Archivgebäude Robert-Koch-Platz 10, einschließlich Lesesaal, voraussichtlich von Mai 2008 bis April 2009 wegen Sanierungsarbeiten geschlossen.

Verkehrsverbindung:

Best�nde:
Abteilungen Baukunst, Bildende Kunst, Film und Medien, Darstellende Kunst, Literatur und Musik (Nachlässe und Sammlungen), Kunstsammlung, Plakatsammlung, Akademie-Archiv, Bibliothek, Brecht-Weigel-Gedenkstätte, Anna-Seghers-Gedenkstätte.

Findmittel:
Elektronische und gedruckte Findbücher.

Ver�ffentlichungen:
Bestandsverzeichnis; Ausstellungskataloge.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Archiv der Berlin-Brandenburgischen Akademie der Wissenschaften

Name:
Archiv der Berlin-Brandenburgischen Akademie der Wissenschaften

Kurzname:

Tr�gereinrichtung:

Strasse:
Jägerstraße 22/23

Postleitzahl:
10117

Ort:
Berlin

Postanschrift:

Telefon:
(030) 20370221

Telefax:
(030) 20370446

E-Mail:
archiv@bbaw.de

Homepage:
http://archiv.bbaw.de

Leitung:
Dr. Wolfgang Knobloch

Mitarbeiter(innen):
9

�ffnungszeiten:
Mo-Fr 8.30-15.45

Verkehrsverbindung:
Hausvogteiplatz (U2)

Best�nde:
Das Akademiearchiv zählt mit seinem einmaligen, nahezu vollständig erhalten gebliebenen Quellenmaterial aus über 300 Jahren Akademiegeschichte zu den ältesten und reichhaltigsten Wissenschaftsarchiven in der Welt. Aufgrund der Vielfalt, Einmaligkeit und Überlieferungskontinuität seiner Bestände stellt das Akademiearchiv eine der bedeutendsten Aufbewahrungsstätten an archivalischen Quellen für die deutsche und europäische Wissenschafts- und Kulturgeschichte dar. Mit seinen zahlreichen von der Literaturarchiv-Gesellschaft im Jahre 1944 übernommenen literarischen Nachlässen hat es zudem die Funktion eines Literaturarchivs.
Der Gesamtbestand des Akademiearchivs aus über 300 Jahren Akademiegeschichte umfasst gegenwärtig 6 000 lfm dienstliche Akten und Nachlässe, über 2 000 Objekte des Kunstbesitzes (Malerei, Plastik, darunter Porträtbüsten und Medaillen, Graphik sowie Kunsthandwerk), ca. 40 000 Fotos zur Akademie- und Wissenschaftsgeschichte, über 500 Tonbänder, 240 Filme und Videokassetten sowie eine Sammlung von ca. 30 000 Zeitungsausschnitten. Die Bestände des Akademiearchivs verteilen sich auf die Historische Abteilung, die Abteilung Akademiebestände nach 1945, die Abteilung Nachlässe sowie die Abteilung Sammlungen.

Findmittel:
Findbücher und -karteien, elektronische Datenbanken.

Ver�ffentlichungen:
Berichte in den Jahrbüchern der ehem. Akademie der Wissenschaften der DDR; Quelleneditionen zur Akademiegeschichte (z. B. A. Einstein in Berlin 1913-1933, T. 1 und 2, Berlin 1979; L. Eulers Wirken an der Berliner Akademie der Wissenschaften 1741-1766, Berlin 1984; Die Altertumswissenschaften an der Berliner Akademie, Berlin 1985; Dokumente einer Freundschaft: Briefwechsel zwischen H. v. Helmholtz und E. du Bois-Reymond 1846-1894, Berlin 1986; "Quod non est in actis, non est in mundo". Das Akademiearchiv und seine Bestände, Berlin 2000.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Archiv des Deutschen Staatsbürgerinnen-Verbandes e. V.

Name:
Archiv des Deutschen Staatsbürgerinnen-Verbandes e. V.

Kurzname:
Deutscher Staatsbürgerinnen-Verband e.V. (DStV)

Tr�gereinrichtung:

Strasse:
Tempelhofer Damm 2

Postleitzahl:
12101

Ort:
Berlin

Postanschrift:

Telefon:
(030) 7858927

Telefax:
(030) 78898244

E-Mail:
stabue@t-online.de

Homepage:

Leitung:
Dr. Irina Hundt

Mitarbeiter(innen):
1

�ffnungszeiten:
Mi 10.00-16.00 und nach Vereinbarung

Verkehrsverbindung:
Platz der Luftbrücke (U6)

Best�nde:
Dokumente, Bücher und Fotos zur Geschichte des Allgemeinen Deutschen Frauenvereines/Deutschen Staatsbürgerinnen-Verbandes 1865-2000, darunter Nachlässe bzw. Splitternachlässe von Louise Otto-Peters, Auguste Schmidt, Gertrud Bäumer, Natalie von Milde/Marie von Bülow, Dorothee von Velsen und Nora Melle.

Findmittel:
Findbücher, Karteikarten.

Ver�ffentlichungen:
Johanna Lemke: Dokumentation der Nachkriegsgeschichte des Deutschen Staatsbürgerinnen-Verbandes. 1947-1980, Berlin 1993; Briefe an den Gefangenen, dessen Welt seine geliebte Freundin ist. Louise Otto an August Peters. 1849-1856, hrsg. von Johanna Lemke, Berlin 1994; Bedeutende Frauen des Allgemeinen Deutschen Frauenvereines/Deutschen Staatsbürgerinnen-Verbandes. 48 Porträts, hrsg. und mit einem Vorwort versehen von Irina Hundt, Berlin 2000; Zwischen Tradition und Moderne. Frauenverbände in der geschichtlichen Kontinuität und im europäischen Diskurs heute. (Zum 135. Jahrestag des Deutschen Staatsbürgerinnen-Verbandes), hrsg. von Irina Hundt und Ilse Kischlat, Berlin 2002; Topographie und Mobilität in der deutschen Frauenbewegung. Ergebnisse des wissenschaftlichen Kolloquiums des Deutschen Staatsbürgerinnen-Verbandes e.V. am 2. November 2002, hrsg. von Irina Hundt und Ilse Kischlat, Berlin 2003.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Archiv des Katholischen Militärbischofs (c/o Katholisches Militärbischofsamt)

Name:
Archiv des Katholischen Militärbischofs (c/o Katholisches Militärbischofsamt)

Kurzname:
AKMB

Tr�gereinrichtung:

Strasse:
Am Weidendamm 2

Postleitzahl:
10117

Ort:
Berlin

Postanschrift:
Postfach 640226, 10048 Berlin

Telefon:
(030) 20617170, 20617171

Telefax:
(030) 20617199

E-Mail:
archiv@katholische-soldatenseelsorge.de; kmbaarchiv@bundeswehr.org

Homepage:
www.katholische-militaerseelsorge.de; www.kmba.de (Organisation/Kurie/Archiv)

Leitung:
Dr. Monica Sinderhauf

Mitarbeiter(innen):
2

�ffnungszeiten:
Di-Do 9.00-16.00, Fr 9.00-12.00 und nach Vereinbarung

Verkehrsverbindung:
Friedrichstraße (S, U6); Tram M1, 12

Best�nde:
Grundstein für die 1978 erfolgte Einrichtung des Archivs war die "Sammlung Werthmann" - Schriftgut der Wehrmachtseelsorge, das Feldgeneralvikar Georg Werthmann aus dem bombenzerstörten Berlin retten konnte. Neben Sachakten sind dies vor allem die Personalakten der Wehrmachtgeistlichen bzw. Kriegspfarrer. Zum Bestand Werthmann zählen darüber hinaus auch die "Akten Werthmann" - Schriftgut zu den Anfängen der Militärseelsorge in der Deutschen Bundeswehr - und sein Nachlass. In den nachfolgenden Jahren kamen dazu noch Nachlässe ehem. Militärgeistlicher des Ersten und Zweiten Weltkriegs und ein nicht vollständiger Bestand an Militärkirchenbüchern aus katholischen Militärpfarreien des ehem. Deutschen Reiches (1730-1945). Das Gros bilden jedoch mittlerweile die Aktenbestände (seit 1956) der Kurie des Katholischen Militärbischofs selbst und ihres nachgeordneten Bereichs (wie z. B. Akten der Leitenden Militärdekane und Standortpfarrer). Darüber hinaus liegt aber auch Dokumentationsgut zur Geschichte der Militärseelsorge vor, das Depositum der Gemeinschaft Katholischer Soldaten (GKS), der Zentralen Versammlung der katholischen Soldaten (ZV) und der "Chartrenser Gemeinschaft". Fotosammlung/Bildarchiv ergänzen das Schriftgut.

Findmittel:
Findbuchmanuskripte, Verzeichnisse, Ablieferungslisten, Datenbanken

Ver�ffentlichungen:
Das Archiv des Katholischen Militärbischofs nach seinem Umzug von Bonn nach Berlin, in: Der Archivar, Jg. 54/H. 4 (2001), S. 310; Am Weidendamm 2. Die Kurie des Katholischen Militärbischofs in Berlin, hrsg. v. Katholischen Militärbischofsamt, Berlin/Mainz 2000; Das Archiv des Katholischen Militärbischofs (AKMB) in Berlin, in: Archivbericht, Nr. 14/15, 8. 9. Jg., Juli 2003, hrsg. im Auftrag des Konsistoriums der Evangelischen Kirche in Berlin-Brandenburg von Jürgen Stenzel, S. 43-48.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Archiv des Pestalozzi-Fröbel-Hauses

Name:
Archiv des Pestalozzi-Fröbel-Hauses

Kurzname:

Tr�gereinrichtung:
Pestalozzi-Fröbel-Haus. Stiftung des öffentlichen Rechts

Strasse:
Karl-Schrader-Straße 7-8 (Haus III, R. 111)

Postleitzahl:
10781

Ort:
Berlin

Postanschrift:

Telefon:
(030) 21730236, 21730121

Telefax:
(030) 21730188

E-Mail:
archiv@pfh-berlin.de

Homepage:
www.pfh-berlin.de/6/archiv.html

Leitung:
Sabine Sander

Mitarbeiter(innen):
1

�ffnungszeiten:
Besuch bitte nur nach Vereinbarung

Verkehrsverbindung:
Eisenacher Straße (U7)

Best�nde:
Das Archiv des Pestalozzi-Fröbel-Hauses bildet zusammen mit dem Alice-Salomon-Archiv das Archiv- und Dokumentationszentrum für soziale und pädagogische Frauenarbeit. Aufgaben des Zentrums sind Sammlung, Erhalt und öffentliche Nutzbarmachung der historischen Quellen, Förderung des Austauschs zwischen Fachhochschulen, Universitäten und Fachschulen sowie Unterstützung von Forschungen. Das Pestalozzi-Fröbel-Haus besteht seit 1873/74 (Träger war zunächst der Berliner Verein für Volkserziehung). Ein ursprünglich einzelner Volkskindergarten wurde nach und nach zu einer sozialpädagogischen Modelleinrichtung ausgebaut. Hier entwickelte die Gründerin Henriette Schrader-Breymann eine eigene Kindergarten-Konzeption und setzte sie praktisch um. Das Pestalozzi-Fröbel-Haus war aber auch gleichzeitig eine Ausbildungsstätte für junge Mädchen und Frauen. Dem 1878 gegründeten Kindergärtnerinnen-Seminar wurde 1885 die Koch- und Hauswirtschaftsschule von Hedwig Heyl angeschlossen (bis 1972). 1925 wurde die Soziale Frauenschule von Alice Salomon in das PFH eingegliedert (bis 1971). Heute ist das Pestalozzi-Fröbel-Haus eine Ausbildungsstätte für Erzieherinnen und Erzieher und Träger von Kindertagesstätten und anderen sozialpädagogischen Einrichtungen. Infolge des 2. Weltkrieges sind viele wichtige Materialien und Dokumente verloren gegangen. Das heutige Archiv wurde 1985 eingerichtet. Durch Schenkungen und Nachlässe konnten Lücken im Bestand aufgefüllt werden, so dass die Geschichte des PFH recht gut dokumentiert ist. Der Bestand wird durch aktuelle Abgaben ständig erweitert. Das Archiv ist kein klassisches Verwaltungsarchiv, die Materialien entstammen den unterschiedlichsten Bereichen. Schwerpunkt sind Materialien zur Geschichte des Hauses wie Vereinsunterlagen, Festschriften, Schul- und Verwaltungsakten, SchülerInnenunterlagen und -arbeiten, Schriften der Gründerinnen und weiterer Mitarbeiterinnen des Hauses, Darstellungen aus den Wohlfahrtseinrichtungen, Vereinszeitungen und ein Fotoarchiv mit ca. 700 Fotografien, Fotoalben u. ä.

Findmittel:
Findbuch, Karteien/Kataloge.

Ver�ffentlichungen:
A. Feustel, S. Sander: Das Archiv- und Dokumentationszentrum für soziale und pädagogische Frauenarbeit, in: Mitteilungen und Materialien. Zeitschrift für Museum und Bildung 56/2001, S. 67-71; A. Feustel (Hrsg.): Sozialpädagogik und Geschlechterverhältnis 1900 und 2000. Dokumentation des Colloquiums zur Eröffnung des Archiv- und Dokumentationszentrums für soziale und pädagogische Frauenarbeit am 18. Mai 2000, Berlin 2002.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Archiv für Diakonie und Entwicklung

Name:
Archiv für Diakonie und Entwicklung

Kurzname:

Tr�gereinrichtung:
Evangelisches Werk für Diakonie und Entwicklung

Strasse:
Caroline-Michaelis-Str. 1

Postleitzahl:
10115

Ort:
Berlin

Postanschrift:
Postfach 40164, 10061 Berlin

Telefon:
(030) 65211-1136, -1139, -1142

Telefax:
(030) 65211-3333

E-Mail:
archiv@diakonie.de

Homepage:
www.diakonie-archiv.de

Leitung:
Dr. Michael Häusler

Mitarbeiter(innen):
4

�ffnungszeiten:
Mo-Fr 10.00-12.00, 13.00-15.00

Verkehrsverbindung:
Nordbahnhof (S1, S2, S25, M8, M10, Bus 245), Naturkundemuseum (U6)

Best�nde:
Das Archiv wurde 1968 gegründet und ist zuständig für die Unterlagen des Bundesverbandes der deutschen Diakonie und seiner Vorgängerorganisationen. Zur Zeit verwahrt das Archiv 62 Einzelbestände mit einem Gesamtumfang von ca. 3 200 Regalmetern. Verbunden mit dem Archiv ist die ca. 90 000 Bände umfassende Historische Bibliothek des Diakonischen Werkes, die die Archivbestände durch eine hervorragende Sammlung von Literatur und Druckschriften zur Inneren Mission und Diakonie in idealer Weise ergänzt. Auswahl aus den Beständen: 1. Central-Ausschuß für Innere Mission (1849-1957): Neben der Zentralregistratur (Bestand CA, 1949-1945) sind separate Bestände von Einzelabteilungen vorhanden, etwa die Abteilung Gesundheitsfürsorge (CA/G, 1922-1956) oder die Apologetische Centrale (CA/AC, 1921-1937). Für die Zeit nach dem 2. Weltkrieg teilen sich die Unterlagen in die Akten der Geschäftsstelle Berlin (CA/O, 1945-1957) und der Geschäftsstelle Bethel (CA/W, 1945-1957). - 2. Hilfswerk der EKD (1945-1957): Das Zentralbüro des Hilfswerks (ZB, 1945-1957) besaß eine Außenstelle für Ostdeutschland, das Zentralbüro Berliner Stelle (ZBB, 1945-1961). Daneben verwahrt das Archiv die Unterlagen der regionalen Hauptbüros in Berlin-Brandenburg. - 3. Diakonisches Werk der EKD (ab 1957): Aus dem Bestand Hauptgeschäftsstelle (HGSt) sind die Akten einzelner Stellen ausgegliedert, die als separate Bestände geführt werden, nämlich die Unterlagen des Präsidialbüros (PB) und die Projektakten der Aktion Brot für die Welt (BfdW-P). Daneben sind die Akten der Berliner Stelle (BSt, 1961-1991) und der Geschäftsstelle Bremen (GBr, 1951-1990) des Diakonischen Werkes der EKD vorhanden. - 4. Diakonisches Werk - IMHW - der Evangelischen Kirchen in der DDR (1952/1969-1991): Schon vor der Verselbständigung des Diakonischen Werkes der Evangelischen Kirchen in der DDR (DWDDR) nahm die im Ostteil Berlins gelegene Dienststelle des Diakonischen Werkes der EKD zentrale Aufgaben für die ostdeutsche Diakonie wahr. Deshalb reicht der Aktenbestand bis in die 1950er Jahre zurück. Einen umfangreichen Teilbestand bilden die Unterlagen des Bauberatungs- und Planungsbüros (1974-1992). Daneben verwahrt das Archiv die Akten des Bevollmächtigten für Brot für die Welt in der DDR (BfdW DDR). - 5. Übergeordnete Verbände: Das Archiv verwahrt auch Unterlagen der im Kirchenkampf gegründeten Arbeitsgemeinschaft der diakonischen und missionarischen Werke und Verbände (AGDMW, 1934-1947), des Internationalen Verbandes für Innere Mission und Diakonie (IV, 1921-1996) und der Diakonischen Arbeitsgemeinschaft evangelischer Kirchen (DAG, ab 1957). - 6. Landes- und Fachverbände der Diakonie: Akten von Landesverbänden bzw. gliedkirchlichen Diakonischen Werken besitzt das Archiv nur aus dem Raum Berlin-Brandenburg; hier ist insbesondere der umfangreiche Bestand des Brandenburgischen Provinzial-Ausschusses für Innere Mission (BP, 1882-1954) zu nennen. Unterlagen von bundes- bzw. reichsweiten Fachverbänden befinden sich u. a. in den Beständen Deutsche Diakonenschaft (DD, 1911-1971), Evangelischer Reichs-Erziehungs-Verband (EREV, 1920-1957), Verband evang. Einrichtungen für geistig und seelisch Behinderte (VEEGSB, 1970-1991) und Verband der Deutschen Evangelischen Bahnhofsmission (VBM, 1946-1977). - 7. Personen: Von den Nachlässen und dienstlichen Handakten sind vor allem jene von Johannes Hesekiel (JH, 1825-1915), Constantin Frick (CF, 1933-1946), Martin Gerhardt (MG, 1924-1952), Theodor Wenzel und Ernst Senf (W/S, 1945-1968) und Heinrich Johannes Diehl (HJD, 1945-1987) zu nennen. - 8. Sammlungen: Neben einer umfangreichen Bildersammlung (BA) mit Fotografien aus allen Bereich der Diakoniegeschichte besitzt das Archiv auch mehrere Sammlungen, die von abgebenden Stellen der Diakonie angelegt wurden. Dazu zählen u. a. eine Sammlung des Statistikreferats des Central-Ausschusses (CA/Stat.Slg.), eine Sammlung zur Wanderer- und Arbeitslosenfürsorge (Slg. WAF), eine Sozialpolitische Sammlung (SP-Slg.) und eine Sammlung zur Geschichte der Diakonie in der DDR (GD).

Findmittel:
Die genannten Bestände sind in der Regel durch Findbücher erschlossen, zum kleineren Teil durch Karteien und Registraturhilfsmitel. Etwa die Hälfte der Bestände ist inzwischen auch elektronisch erschlossen. Bestände und Findmittel sind allgemein zugänglich gemäß der Ordnung für die Benutzung kirchlichen Archivguts vom 15.5.1987 (Abl EKD 1987, 281 ff.).

Ver�ffentlichungen:
Helmut Talazko: Neubau für das Archiv des Diakonischen Werkes in Berlin; in: Der Archivar 31 (1978), S. 101 f.; ders.: Archiv des Diakonischen Werkes der EKD; in: Der Archivar 45 (1992), S. 364 f.; Findbuch zum Bestand Zentralbüro des Hilfswerks (1945-1957) im Archiv des Diakonischen Werkes der Evangelischen Kirche in Deutschland, bearb. v. Johannes Michael Wischnath (= Veröff. d. Arbeitsgemeinschaft der Archive und Bibliotheken in der evangelischen Kirche 14), Neustadt/Aisch 1987; Jochen-Christoph Kaiser: Soziale Arbeit in historischer Perspektive. Zum geschichtlichen Ort der Diakonie in Deutschland (FS Helmut Talazko), Stuttgart 1998; Michael Häusler: Reisepredigerberichte über deutsche Wanderarbeiter in den Niederlanden im Archiv des Diakonischen Werkes der EKD - Historische und quellenkundliche Aspekte; in: Aus evangelischen Archiven 39 (1999), S. 75-84.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Archiv Grünes Gedächtnis der Heinrich-Böll-Stiftung

Name:
Archiv Grünes Gedächtnis der Heinrich-Böll-Stiftung

Kurzname:

Tr�gereinrichtung:

Strasse:
Eldenaer Straße 35

Postleitzahl:
10247

Ort:
Berlin

Postanschrift:

Telefon:
(030) 28534260

Telefax:
(030) 285345260

E-Mail:
archiv@boell.de

Homepage:
www.boell.de/archiv, www.petra-kelly-archiv.de

Leitung:
Dr. Christoph Becker-Schaum (Archivleiter), Robert Camp (Nachlass Petra K. Kelly)

Mitarbeiter(innen):
5

�ffnungszeiten:
Mo, Di, Do 9.00-17.00, Mi 12.00-20.00, Fr 9.00-16.00

Verkehrsverbindung:
Storkower Straße (S4, 8); Samariterstraße (U5, Tram 21)

Best�nde:
Das Archiv Grünes Gedächtnis der Heinrich-Böll-Stiftung hat die umfassende Sicherung der Archivalien aus den Strukturen der Partei Bündnis 90/Die Grünen im Gesamtzusammenhang ihrer gesellschaftlichen Grundströmung zur Aufgabe. Es bewahrt und erschließt die Quellen zur Entstehung und Entwicklung der Partei Bündnis 90/Die Grünen und deren Umsetzung von gesellschaftspolitischen Initiativen und Forderungen in die Tagespolitik und macht sie der wissenschaftlichen Forschung und der Öffentlichkeit zugänglich. Zu den Provenienzen des Archivs zählen außerdem Initiativen, Organisationen, Verbände und Persönlichkeiten der Neuen Sozialen Bewegungen von überregionaler und exemplarischer Bedeutung. Gesammelt werden Materialien und Akten der Partei und ihrer Fraktionen sowie Archivalien überregionaler Initiativen und persönliche Unterlagen grüner Politikerinnen und Politiker. Der Umfang der Archivbestände beträgt zur Zeit ca. 4 000 lfm. Hinzu kommen eine Präsenzbibliothek mit ca. 30 000 Bänden und ca. 1 150 Zeitschriftenreihen, 2 500 Plakate, 30 000 Fotos, 400 Videofilme, 1 900 Tonkassetten und 200 Tonbänder. Die Archivalien, Literatur- und Sammlungsbestände werden mittels des Archivdatenbanksystems FAUST verzeichnet und erschlossen, das den BenutzerInnen vielfältige Recherchemöglichkeiten eröffnet. Die insgesamt ca. 200 einzelnen Bestände zerfallen in acht Hauptbestandsgruppen, von denen etwa die Hälfte personenbezogene Bestände sind. Unter den Nachlässen ist besonders der von Petra Kelly hervorzuheben, unter den institutionellen Beständen die Akten der Bundestagsfraktionen seit 1983, die des Bundesverbandes und der meisten Landesverbände seit der Gründung der Grünen 1979/1980. A - Personenbezogene Bestände/Nachlässe und Deposita, B - Bundesverband Bündnis 90/Die Grünen, C - Landesverbände Bündnis 90/Die Grünen, D - Parteinahe Institutionen, E - Initiativen, Verbände und Vereine der Neuen Sozialen Bewegungen, F - Sammlungen, u. a. Plakatsammlung, Fotosammlung, Film- und Tondokumente, Pressemitteilungen, Presseausschnitte, G - Zeitgeschichtliche Sammlungen, H - Kleine Erwerbungen. Die Bibliothek dient der Sammlung aller Veröffentlichungen von Bündnis 90/Die Grünen, angefangen bei den Publikationen des Bundesvorstandes bis hin zu den Rundbriefen der Kreisverbände unter Einschluss der Veröffentlichungen bündnisgrüner Autor/innen. Neben den Verlagspublikationen wird insbesondere die Graue Literatur systematisch gesammelt. Die Zeitschriftensammlung umfasst ca. 1 150 Titel, darunter ca. 200 Periodika der Grünen. Das Sammlungsgebiet wird ergänzt durch die Standardwerke der sozialwissenschaftlichen und der zeitgeschichtlichen Literatur mit Bezug auf die Grünen und die Neuen Sozialen Bewegungen. Die Bibliothek ist eine reine Präsenzbibliothek. Sie enthält zur Zeit ca. 30 000 Einzeltitel aus den Sammlungsgebieten: Veröffentlichungen der Partei Bündnis 90/Die Grünen, Veröffentlichungen bündnisgrüner Politiker/innen, Geschichte der Bundesrepublik seit der Studentenbewegung, Bündnis 90/Die Grünen im Parteiensystem der Bundesrepublik, Umweltbewegung und Anti-Atom-Bewegung, Frauenbewegung und Friedensbewegung, Internationale Solidaritätsbewegung und Bürgerbewegung in der ehemaligen DDR. Die dokumentarischen Sammlungen des Archivs umfassen Plakate und Fotos, Tonband- und Filmaufnahmen, Pressemitteilungen und Presseauswertungen. Ein Teil der Sammlungen befindet sich zur Zeit noch im Aufbau.

Findmittel:
Findbücher zu einzelnen Beständen, insbesondere zu den Archivalien der Bundestagsfraktion, zum Petra-Kelly-Nachlass und zu Deposita von Bundestagsabgeordneten der Grünen.

Ver�ffentlichungen:

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Archiv Schreibende ArbeiterInnen

Name:
Archiv Schreibende ArbeiterInnen

Kurzname:

Tr�gereinrichtung:
SchreibART e. V.

Strasse:
Im Haus NILES Aus- und Weiterbildung gGmbH, Gehringstraße 39

Postleitzahl:
13088

Ort:
Berlin

Postanschrift:

Telefon:
030 96248234 (Archiv), 030 94380843 (Frau Pieschke)

Telefax:

E-Mail:
midojue@t-online.de

Homepage:
www.schreibartev.de

Leitung:
Jörg Erdmann

Mitarbeiter(innen):
3 (ehrenamtlich)

�ffnungszeiten:
Do 09.00-15.00, nach telefonischer Vereinbarung

Verkehrsverbindung:
Bus 255; 259; X54; 155

Best�nde:
Das Archiv Schreibende ArbeiterInnen wurde 1992 mit der Absicht gegründet, die nichtprofessionelle Literatur der DDR als besondere Spezies zeitgeschichtlicher Quellen zu sammeln und zu bewahren. Den zeitlichen Schwerpunkt bilden Unterlagen aus den Jahren 1959-1989. Seit 1994 sind die Archivbestände für Benutzer zugänglich.

Das Archiv bewahrt:

- eine umfangreiche Sammlung von Originaldokumenten aus den Zirkeln Schreibender Arbeiter, u.a. Chroniken, Korrespondenzen, Wettbewerbsaufrufe und -beiträge, Urkunden, Gutachten, Berichte usw.

- literarische Manuskripte und Typoskripte sowie Tagebücher einzelner Autoren,

- Zeitungs- und Zeitschriftenartikel zur Zirkelarbeit;

- Bildmaterial (Fotos, Grafiken)

- Brigadetagebücher sowie

- eine Handbibliothek mit Fachzeitschriften und methodischen Fachbüchern zur Bewegung schreibender Arbeiter, Anthologien, Monografien.

Findmittel:
Datenbanken

Ver�ffentlichungen:
Reiz und Phänomen: Die Literatur der schreibenden Arbeiter. Ein Diskurs im Spannungsfeld der Erfahrungen von Vision und deutsch-deutscher Realität. Hrsg. vom Archiv Schreibender ArbeiterInnen, Berlin 1996; J. Kögel: Das „Archiv Schreibende ArbeiterInnen“, in: JahrBuch für Forschungen zur Geschichte der Arbeiterbewegung 2011/I, S. 179-185; U. Frings: Der Staat, der unser ist. Urkunden und Orden: Das Archiv schreibender Arbeiterinnen der ehemaligen DDR; in: Frankfurter Rundschau vom 09. Juni 1994, S. 11; J. Janert: Greif zur Feder Kumpel! In: Rheinischer Merkur Nr. 40 vom 02. Oktober 2008, S. 19.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Archiv und Gutachterstelle für Deutsches Schul- und Studienwesen

Name:
Archiv und Gutachterstelle für Deutsches Schul- und Studienwesen

Kurzname:

Tr�gereinrichtung:
Senatsverwaltung für Bildung, Jugend und Wissenschaft

Strasse:
Flottenstraße 28-42

Postleitzahl:
13407

Ort:
Berlin

Postanschrift:
Senatsverwaltung für Bildung, Jugend und Wissenschaft, Flottenstraße 28-42, 13407 Berlin

Telefon:
(030) 901984300

Telefax:
(030) 901984152

E-Mail:
archiv@senbwf.berlin.de

Homepage:

Leitung:
Christine Bernebée-Say

Mitarbeiter(innen):
3

�ffnungszeiten:
Nach Vereinbarung (Mo-Do 9.30-14.30, Fr 9.30-13.30)

Verkehrsverbindung:
S-Bahn S1, S2, S25; U-Bahn U8; Bus 120, 122, 322

Best�nde:
Unterlagen folgender Einrichtungen: Fachschule für Binnenhandel, Ingenieurschule für Chemie, Ingenieurschule für Bauwesen, Fachschule für Werbung und Gestaltung, Fachschule für Außenwirtschaft „Josef Orlopp“ Berlin (auch Staatliche Fachschule für Betriebswirtschaft an der Hochschule für Ökonomie), Institut für Lehrerbildung „Clara Zetkin“ Berlin, Kombinat der Sonderheime für Psychodiagnostik und päd.-psych. Therapie, Kinderheime, Päd.-med. Zentrum Berlin, Sportstättenbetrieb Berlin, Verkehrsbildungsinstitut, Akademie der Pädagogischen Wissenschaften, Kinder- und Jugendsportschulen „Werner Seelenbinder“, „Heinrich Rau“, „Ernst Grube“, „Paul Gesche“, Berufsamt Berlin, Jugendaufbauwerk Berlin (JAW). Schulakten. Archivakten. Unterlagen und Rechtsvorschriften zur schulgeschichtlichen Entwicklung in Deutschland. Lehrmaterialien DDR (Ausbildungsvorschriften, Lehrpläne, Studienpläne, Stundenpläne). Zeugnisarchiv der Gutachterstelle.

Findmittel:

Ver�ffentlichungen:
Informationen zur DDR-Pädagogik: Nachrichten - Zeitschriftenschau - Gesetze, Verordnungen, Vorschriften. Hrsg.: Pädagogisches Zentrum Berlin, Referat Gutachterstelle für Dt. Schul- und Studienwesen (Bearb.). Erscheinungsweise: 3 mal jährlich 1. Jg. 1973 bis 1990 Nr. 2, dann Erscheinen eingestellt.

Schlagw�rter:
Archiv Zeugnisarchiv Gutachterstelle Lohn- und Gehaltsakten Personalakten Studentenakten Schulakten Zeugnisse Fachschulen Ingenieurschulen Bildungseinrichtungen Bildungsabschlüsse DDR Gleichwertigkeit

Archivtyp:
nicht öffentlich zugängliches Archiv

Bild:

xxxxxx

Archiv zur Geschichte der Max-Planck-Gesellschaft

Name:
Archiv zur Geschichte der Max-Planck-Gesellschaft

Kurzname:

Tr�gereinrichtung:
Max-Planck-Gesellschaft zur Förderung der Wissenschaften e.V.

Strasse:
Boltzmannstraße 14

Postleitzahl:
14195

Ort:
Berlin

Postanschrift:

Telefon:
(030) 84133701

Telefax:
(030) 84133700

E-Mail:
mpg-archiv@archiv-berlin.mpg.de

Homepage:
www.archiv-berlin.mpg.de

Leitung:
Prof. Dr. Eckart Henning M.A.

Mitarbeiter(innen):
10

�ffnungszeiten:
Mo-Do 9.00-16.00, Fr 9.00-15.00, Benutzung nach Terminvereinbarung

Verkehrsverbindung:
Thielplatz (U1)

Best�nde:
a) Geschichte: Das 1975 im ehemaligen Kaiser-Wilhelm-Institut für Zellphysiologie (heute: Otto-Warburg-Haus) in Berlin-Dahlem eingerichtete und 1978 eröffnete Archiv umfasst Archivalien der verschiedensten Art, ungedrucktes wie gedrucktes Material, und auch audiovisuelle Dokumente zur Geschichte der zunächst 1946 in Bad Driburg entstandenen "Max-Planck-Gesellschaft" in der Britischen Zone wie der 1948 in Göttingen gegründeten, heute - nicht vereinsrechtlich, aber doch tatsächlich - in München ansässigen Max-Planck-Gesellschaft zur Förderung der Wissenschaften. Es bezieht aber auch die Akten ihrer Vorläuferin, der 1911 in Berlin ins Leben gerufenen und dort erst 1960 liquidierten Kaiser-Wilhelm-Gesellschaft (Historisches Archiv), mit ein. Der Namenswechsel der nach dem 2. Weltkrieg neugegründeten Gesellschaft erfolgte auf alliierten Wunsch. b) Art der Bestände: Akten der Kaiser-Wilhelm-Gesellschaft und ihrer Institute (Abteilung I), desgl. der Max-Planck-Gesellschaft, besonders derjenigen Institute, Forschungsstellen oder Abteilungen, die nicht weitergeführt werden (Abteilung II); etwa 200 (Teil-)Nachlässe von Mitgliedern, leitenden Mitarbeitern und Freunden der Kaiser-Wilhelm-/Max-Planck-Gesellschaft, darunter von den Nobelpreisträgern Carl Bosch, Walter Bothe, Adolf Butenandt, Peter Debye, Otto Hahn, Richard Kuhn, Max v. Laue, Feodor Lynen, Ernst Ruska u. Otto Warburg (Abteilung III); Karten und Baupläne von Instituten und Einrichtungen beider Gesellschaften (Abteilung IV); Archivische Sammlungen und Selekte, auch nichtverbaler Dokumente (wie Medaillen, Büsten, Realien), wobei die personenbezogenen Sammlungen zu Albert Einstein, Fritz Haber, Max Planck oder Hans Spemann die wichtigsten sind (Abteilung V); Bilder-Sammlung, überwiegend fotografische Arbeiten, von Innen- bzw. Außenaufnahmen aller zur Kaiser-Wilhelm-/Max-Planck-Gesellschaft gehörenden Institute sowie ihrer Mitarbeiter (Abteilung VI); das Film- und Schallarchiv enthält in klimatisierten Räumen vor allem Dokumentarfilme, ergänzt durch eigene Videoaufzeichnungen von Fernsehsendungen, ferner Schallplatten, Tonbänder bzw. -kassetten (Abteilung VII). Außerhalb der Provenienzbestände (I. bis IV.) und der Sammlungen (V. bis VII.) des Archivs liegt der Dokumentationsbereich, in dem sog. Graue Literatur und Zeitungsausschnitte instituts- bzw. personenbezogen aufbereitet werden (IX.), der daneben Archivalienreproduktionen (VIII.), insbes. Faksimiles, Bildmontagen usw. aus früheren Ausstellungen sowie Nachweise fremder Archivalien und Bestandverzeichnisse anderer Archive (X.) enthält, u. a. eine Teilverfilmung des Nachlasses Emil Fischer aus der Bancroft Library der University of California. Bibliothek: Präsenzbibliothek; 32 000 Bde. mit einem jährlichen Zuwachs von ca. 1 000 Bden., ca. 200 laufend gehaltene Zeitschriften, davon 80 ausländische Titel. Sonderdrucksammlung von Kaiser-Wilhelm-/Max-Planck-Instituten und Wissenschaftlichen Mitgliedern. Sammelgebiete: 1. Literatur zur Geschichte der Kaiser-Wilhelm-/Max-Planck-Gesellschaft und ihrer Institute bzw. Veröffentlichungen der bzw. über die Wissenschaftlichen Mitglieder beider Gesellschaften, 2. Literatur zur Wissenschaftsgeschichte und Forschungsorganisation des 20. Jahrhunderts allgemein.

Findmittel:
Band- und Karteirepertorien, Datenbank (im Aufbau), Online-Katalog für die Bibliothek.

Ver�ffentlichungen:
Archivführer: Archiv zur Geschichte der Max-Planck-Gesellschaft, Berlin (= Max-Planck-Gesellschaft. Berichte u. Mitteilungen 1/88), 2., neubearb. Aufl., München 1992; Schriftenreihen des Archivs: Veröffentlichungen aus dem Archiv zur Geschichte der Max-Planck-Gesellschaft, Berlin 1988 ff.: Bd 1: Eckart Henning u. Marion Kazemi: Chronik der Kaiser-Wilhelm-Gesellschaft zur Förderung der Wissenschaften, 1988; Bd. 2: Jutta Ellwanger: Forscher im Bild. Teil I: Wissenschaftliche Mitglieder der Kaiser-Wilhelm-Gesellschaft zur Förderung der Wissenschaften, 1989; Bd. 3: Claudia Bergemann: Mitgliederverzeichnis der Kaiser-Wilhelm-Gesellschaft zur Förderung der Wissenschaften. Teil A-K u. L-Z, 1990/91; Bd. 4: Eckart Henning u. Marion Kazemi: Chronik der Max-Planck-Gesellschaft zur Förderung der Wissenschaften unter der Präsidentschaft Otto Hahns (1946-1960), 1992; Bd. 5: Glenys Gill u. Dagmar Klenke: Institute im Bild. Teil I: Bauten der Kaiser-Wilhelm-Gesellschaft zur Förderung der Wissenschaften, 1993; Bd. 6: Petra Hauke: Bibliographie zur Geschichte der Kaiser-Wilhelm-/Max-Planck-Gesellschaft, ihrer Institute, Forschungsstellen und Arbeitsgruppen. T. I-III, 1994; Bd. 7: Heinrich Parthey: Bibliometrische Profile von Instituten der Kaiser-Wilhelm-Gesellschaft zur Förderung der Wissenschaften (1923-1943), 1995; Bd. 8: Dirk Ullmann: Quelleninventar Max Planck, 1996; Bd. 9: Christel Wegeleben: Beständeübersicht des Archivs zur Geschichte der Max-Planck-Gesellschaft, 1997; Bd. 10: Ulrike Kohl: Quelleninventar zur Kaiser-Wilhelm-Gesellschaft im Nationalsozialismus, 1997; Bd. 11: Susanne Uebele: Institute im Bild. Teil II: Bauten der Max-Planck-Gesellschaft zur Förderung der Wissenschaften, 1998; Bd. 12: Annette Vogt: Wissenschaftlerinnen in Kaiser-Wilhelm-Instituten, 1999; Bd. 13: Eckart Henning: Beiträge zur Wissenschaftsgeschichte Dahlems, 2000; Bd. 14: Petra Hauke: Literatur über Max Planck. Bestandsverzeichnis, 2001; Bd. 15: Marion Kazemi: Nobelpreisträger in der Kaiser-Wilhelm-/Max-Planck-Gesellschaft zur Förderung der Wissenschaften, 2002; Bd. 16: Eckart Henning u. Marion Kazemi: Dahlem - Domäne der Wissenschaft. Dahlem - Domain of Science. Ein Spaziergang zu den Berliner Instituten der Kaiser-Wilhelm-/Max-Planck-Gesellschaft im 'deutschen Oxford'. Deutsch u. englisch, 2002; Bd. 17: Eckart Henning: Führer durch das Archiv zur Geschichte der Max-Planck-Gesellschaft. Anlässlich des 25jährigen Jubiläums 1978-2003 unter Beteiligung aller Mitarbeiter neu bearbeitet, 2003.- Dahlemer Archivgespräche, Bd. 1, 1996 ff.;- Pallas Athene. Beiträge zur Universitäts- und Wissenschaftsgeschichte: Bd. 3: Ulrich Sucker: Das "Kaiser-Wilhelm-Institut für Biologie". Seine Gründungsgeschichte, seine problemgeschichtlichen und wissenschaftstheoretischen Voraussetzungen (1911-1916), 2002; Bd. 5: Ulrike Kohl: Die Präsidenten der Kaiser-Wilhelm-Gesellschaft im Nationalsozialismus. Max Planck, Carl Bosch und Albert Vögler zwischen Wissenschaft und Macht, 2002; weitere Veröffentlichungen: 50 Jahre Max-Planck-Gesellschaft zur Förderung der Wissenschaften, Berlin 1998. T. I: Eckart Henning u. Marion Kazemi: Chronik der Max-Planck-Gesellschaft zur Förderung der Wissenschaften 1948-1998, mit e. Geleitw. v. H. Markl. T. 2: Eckart Henning u. Dirk Ullmann: Wissenschaftliche Mitglieder der Max-Planck-Gesellschaft zur Förderung der Wissenschaften im Bild, unter Mitarb. v. M. Kazemi u. mit e. Geleitw. v. W. Singer; Horst Meermann: Es bleibt in der Familie. Aufgaben und Ziele der Bibliothek und des Archivs in Berlin, in: MPG-Spiegel 1977, H. 3, S. 22 f.; Rolf Neuhaus: Bibliothek und Archiv zur Geschichte der Max-Planck-Gesellschaft, in: Der Archivar 31 (1978), Sp. 250 f.; Eckart Henning: Tresor der Wissenschaft und Gedächtnis der Verwaltung. Bilanz nach 9 Jahren, in: MPG-Spiegel 1984, H. 2, S. 41-45; ders.: Ein märkisches Herrenhaus im "deutschen Oxford". Zur Baugeschichte des ehem. Kaiser-Wilhelm-Instituts für Zellphysiologie [heute Archiv!] und seines Vorbildes in Groß Kreutz, in: Jahrbuch für brandenburgische Landesgeschichte 38 (1987), S. 202-232; Eckart Henning: Die "Haber-Sammlung" im Archiv zur Geschichte der Max-Planck-Gesellschaft in Berlin, in: Berichte zur Wissenschaftsgeschichte 13 (1990), S. 34-37; ders.: Wahrheit und Wert eines wissenschaftshistorischen Archivs, in: Vorträge des XIV. Fortbildungsseminars für Bibliotheksleiter der Max-Planck-Institute, 18.-20. April 1988 in Berlin, hrsg. von der Generalverwaltung der MPG. Sachgebiet wissenschaftliches Informations-, Dokumentations- und Bibliothekswesen, München 1988, S. 50-66; ders.: Das Archiv zur Geschichte der Max-Planck-Gesellschaft. Vorgeschichte, Gründung und Anfangsjahre einer Berliner Forschungsstätte für Wissenschaftsgeschichte (1975-1990), in: Dona Brandenburgica, Festschrift für Werner Vogel zum 60. Geburtstag (= Jahrbuch für brandenburgische Landesgeschichte, Bd. 41), Berlin 1990, S. 291-320.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Archiv zur Geschichte von Tempelhof und Schöneberg

Name:
Archiv zur Geschichte von Tempelhof und Schöneberg

Kurzname:

Tr�gereinrichtung:
Bezirksamt Tempelhof-Schöneberg von Berlin

Strasse:
Hauptstraße 40-42

Postleitzahl:
10827

Ort:
Berlin

Postanschrift:

Telefon:
(030) 75606214, 75606164, 75606163

Telefax:
(030) 75606329

E-Mail:
archiv@ba-temp.verwalt-berlin.de

Homepage:

Leitung:
Petra Zwaka, Veronika Liebau

Mitarbeiter(innen):
1

�ffnungszeiten:
Mi 14.00-19.00 (nach Voranmeldung, weitere Termine nach telefonischer Absprache)

Verkehrsverbindung:
Eisenacher Straße (U7); Schöneberg (S); Innsbrucker Platz (S4, 45, 46, U4); Rathaus Schöneberg (U4); Bus 104, 148, 187, 204, 348

Best�nde:
Das Archiv für die Geschichte von Tempelhof und Schöneberg ist Teil der Tempelhof-Schöneberg Museen und sammelt als lokalhistorisches Archiv Materialien zu den Bezirken Tempelhof und Schöneberg. Durch die Fusion der Bezirke wurden die Archivsammlungen beider Bereiche zusammengelegt. Die Schöneberger Sammlung wurde nach Zerstörung im Zweiten Weltkrieg seit den 50er Jahren wieder neu aufgebaut, zunächst aus historischen Akten, Karten, Plänen und Fotosammlungen des Bezirksamtes selbst. Dies wurde im Lauf der Jahre durch Ankäufe und Schenkungen zu einer umfangreichen Dokumenten- und Textsammlung, Bibliothek sowie Foto- und Postkartensammlung erweitert.
Das Archiv des Bezirks Tempelhof wurde 1949 auf Beschluss des Bezirksamts gegründet.
Schwerpunktthemen beider Sammlungen sind: allgemeine Stadtentwicklung (Straßen, Plätze, Parks, Friedhöfe, öffentliche Gebäude u. ä.), Personen und Gedenktafeln, sozialgeschichtliche Dokumente (Politik, Geschichte, darunter besonders die Zeit des Nationalsozialismus, Militär, Handel und Gewerbe, Verkehr, einzelne Bevölkerungsgruppen, darunter besonders Frauen).
Die Fotosammlung umfasst dabei insgesamt ca. 24 000 Originalfotos, Prints und Originalpostkarten sowie ca. 24 000 Negative. Das Dokumenten- und Textarchiv umfasst ca. 26 000 Texte; neben den o. g. inhaltlichen Schwerpunkten gibt es für Schöneberg eine besonders große Sammlung zur Geschichte des Nationalsozialismus und zur Judenverfolgung. Das Textarchiv wird durch aktuelle Presseauswertung laufend erweitert.
Das Zeitungsarchiv beider Bezirke umfasst mehr als 100 Jahrgänge historischer Regionalzeitungen ab 1880 bis in die Gegenwart. In der Präsenzbibliothek finden sich ca. 5 000 Bände zur Regional- und Berlingeschichte, darunter die Berliner Adressbücher der Jahrgänge 1907 bis 1960. Zur Stadtentwicklung Schönebergs sind über 60 historische Originalkarten und -pläne mit dem Schwerpunkt 19. und 20. Jahrhundert vorhanden.

Findmittel:
Der Schöneberger Teil der Sammlung wird durch Orts-, Personen- und systematische Karteien erschlossen. Die Tempelhofer Sammlung wird derzeit für die Eingabe in ein Archiv-Computerprogramm vorbereitet, mit dem zu einem späteren Zeitpunkt auch die Schöneberger Bestände erfasst werden können.

Ver�ffentlichungen:
Petra Zwaka: Schöneberg auf dem Weg nach Berlin. Historische Pläne, Texte und Fotografien. Ein Bilder- und Lesebuch, hrsg. vom Bezirksamt Schöneberg, 2. Auflage, 1998; Schöneberg in historischen Postkarten, hrsg. vom Bezirksamt Schöneberg/Schöneberg Museum, Berlin 1998; Experiment Stadt. Schöneberg 1898-1998, CD-Rom hrsg. vom Bezirksamt Schöneberg/Schöneberg Museum, 1998; Das andere Friedenau. Spaziergänge durch 125 Jahre Kunst-, Literatur- und Baugeschichte, hrsg. vom Bezirksamt Schöneberg/Schöneberg Museum, 2. Auflage, 1999; Orte des Erinnerns, hrsg. vom Kunstamt Schöneberg, Schöneberg Museum in Zusammenarbeit mit der Gedenkstätte Haus der Wannsee-Konferenz, 2. Auflage, 1999; Blicke ins Quartier 1949-2000, hrsg. vom Bezirksamt Tempelhof-Schöneberg/Schöneberg Museum, 2001; Hörrundgänge zum Nollendorfplatz, Viktoria-Luise-Platz und zur Alten Dorfaue in Schöneberg.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Auswärtiges Amt. Politisches Archiv

Name:
Auswärtiges Amt. Politisches Archiv

Kurzname:

Tr�gereinrichtung:

Strasse:
Kurstraße 36

Postleitzahl:
10117

Ort:
Berlin

Postanschrift:
Auswärtiges Amt, Ref. 117, 11013 Berlin

Telefon:
(01888) 172159 (Sekretariat), 172179 (Lesesaal)

Telefax:
(01888) 173948

E-Mail:
117-r@auswaertiges-amt.de

Homepage:
www.auswaertiges-amt.de/archiv

Leitung:
Vortragender Legationsrat I. Klasse Dr. Ludwig Biewer (Archivleiter), Vortragender Legationsrat Dr. Johannes Freiherr von Boeselager (stv. Leiter)

Mitarbeiter(innen):
27

�ffnungszeiten:
Mo-Do 8.30-16.30, Fr 8.30-15.00. Der Personalausweis ist am Eingang gegen Aushändigung einer Besucherkarte zu hinterlegen. Jacken und Taschen werden durchleuchtet.

Verkehrsverbindung:
Hausvogteiplatz (U2); Spittelmarkt (M48); Werderscher Markt (Bus 147).

Best�nde:
Die Aufgaben des Politischen Archivs sind gesetzlich definiert durch das Gesetz über die Sicherung und Nutzung von Archivgut des Bundes (Bundesarchivgesetz - BArchG) vom 6. Januar 1988 (BGBl 1988 I, S. 62 ff.) und durch § 10 des Gesetzes über den Auswärtigen Dienst (GAD) vom 30. August 1990 (BGBl 1990 I, S. 1842 ff.). Die Arbeitseinheit Politisches Archiv und Historischer Dienst (Referat 117) ist Teil der Zentralabteilung des Auswärtigen Amts. Zu ihren Aufgaben gehört die Archivierung der völkerrechtlichen Verträge des Deutschen Reiches, der Bundesrepublik Deutschland und der Deutschen Demokratischen Republik einschließlich der Ressortabkommen sowie die Aufbereitung, Sicherung und Nutzbarmachung der Aktenbestände des Auswärtigen Amts (Zentrale), des Ministeriums für Auswärtige Angelegenheiten der ehemaligen Deutschen Demokratischen Republik und der deutschen Auslandsvertretungen. Die Auskunfterteilung erstreckt sich auf die amtliche Benutzung, z. B. für Ausarbeitungen zur Geschichte bilateraler Beziehungen oder in Rechts- und Staatsangehörigkeitssachen, sowie die wissenschaftliche Benutzung einschließlich der Gewährung der Akteneinsicht im Lesesaal des Archivs. Darüber hinaus ist das Referat zuständig für Fragen zur Geschichte des Auswärtigen Dienstes und die Erstellung des biographischen Handbuchs der Mitarbeiter des höheren auswärtigen Dienstes bis 1945.
Akten, die älter sind als 30 Jahre, stehen nach den Bestimmungen des Bundesarchivgesetzes und der Benutzungsordnung für das Politische Archiv vom 5. Dezember 1990 zur Benutzung offen. Schriftgut, das sich auf natürliche Personen bezieht, darf grundsätzlich erst 30 Jahre nach dem Tode der Betroffenen benutzt werden. Anträge auf Benutzung des Politischen Archivs sind schriftlich an das Auswärtige Amt zu richten. Darin sind Thema, Zweck, Zeitpunkt und voraussichtliche Dauer der beabsichtigten Studien so genau wie möglich anzugeben. Bei Dissertationsvorhaben ist eine Bestätigung durch den die Arbeit betreuenden Hochschullehrer erwünscht. Die Benutzung von Archivalien ist erst nach der schriftlichen Genehmigung des Auswärtigen Amts möglich.
Das Politische Archiv ist ein Präsenzarchiv. Eine Ausleihe von Akten nach auswärts findet nicht statt. Sicherungsverfilmte Akten werden als Mikrofiche bzw. Mikrofilm vorgelegt. Die Benutzung von völkerrechtlichen Verträgen im Original ist nicht möglich.
Das Politische Archiv verwahrt Schriftgut im Umfang von ca. 26 km sowie zehntausende bi- und multilaterale völkerrechtliche Verträge aus der Zeit von 1811 bis heute. Das Archiv unterscheidet folgende Bestandsgruppen: Akten des Deutschen Reiches (R-Bestand), ca. 1867 bis 1945, Akten der Bundesrepublik (B-Bestände), ab 1949, Akten des ehemaligen Ministeriums für Auswärtige Angelegenheiten (MfAA-Bestand), 1949-1990, sowie Akten der deutschen Auslandsvertretungen (AV-Bestände). Die Bestandsgruppe B gliedert sich in die Bestände B 1 bis B 231. Zur Ergänzung der Bestände werden Nachlässe, Erinnerungsaufzeichnungen und Handakten von Diplomaten gesammelt. Darüber hinaus sind in der Bildsammlung über 10 000 Fotos von deutschen Diplomaten und diplomatischen Vertretungen vorhanden. Infolge Kriegseinwirkung sind nicht mehr alle ehedem bis 1945 vorhanden gewesenen Akten erhalten. Einige Akten des Auswärtigen Amts befinden sich heute im Bundesarchiv (z. B. B 305: Zentrale Rechtsschutzstelle). Eine Handbibliothek mit Nachschlagewerken und Publikationen aus den Akten des Politischen Archivs ist als Präsenzbestand im Lesesaal frei zugänglich.

Findmittel:
Die Bestände sind erschlossen durch gedruckte Kataloge, Findbücher, Datenbanken, Karteien oder vorarchivische Verzeichnisse. Findmittel sowie Akten- und Ordnungspläne können im Lesesaal eingesehen werden.

Ver�ffentlichungen:
Biographisches Handbuch des deutschen Auswärtigen Dienstes 1871-1945, zurzeit 3 Bde., A-R, Paderborn 2000 ff.; Akten zur Auswärtigen Politik der Bundesrepublik Deutschland, hrsg. im Auftrag des Auswärtigen Amts vom Institut für Zeitgeschichte, München 1994-2011 (die Reihe wird jährlich fortgesetzt, bereits erschienen sind die Jahresbände 1949/50-1953 und 1962-1980).

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Axel Springer Verlag Infopool

Name:
Axel Springer Verlag Infopool

Kurzname:

Tr�gereinrichtung:

Strasse:
Axel-Springer-Straße 65

Postleitzahl:
10888

Ort:
Berlin

Postanschrift:

Telefon:
(030) 259172000

Telefax:
(030) 259171660

E-Mail:
INFOPOOL-TEXT-BERLIN@AXELSPRINGER.DE

Homepage:
www.asv-infopool.de

Leitung:
Martin Adolph

Mitarbeiter(innen):
13

�ffnungszeiten:
Mo-Fr 8.30-16.00

Verkehrsverbindung:
Kochstraße (U6); Bus 129

Best�nde:
35 000 Zeitungsbände ab 1761 (Schwerpunkt Berlin), 35 Millionen Zeitungsartikel ab 1945, Handbibliothek mit 25 000 Bänden, CD-ROM, Datenbanken. Zugänglich nach Vereinbarung. Bei Interesse kann eine Gebührenordnung zugesandt werden.

Findmittel:
Datenbanken, Karteien.

Ver�ffentlichungen:

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Bankmuseum in der Commerzbank

Name:
Bankmuseum in der Commerzbank

Kurzname:

Tr�gereinrichtung:

Strasse:
Potsdamer Straße 125

Postleitzahl:
10783

Ort:
Berlin

Postanschrift:

Telefon:
(030) 26532225, 26533733

Telefax:
(030) 26532798

E-Mail:

Homepage:

Leitung:
Kurt Kroschinski, Christian Kehl

Mitarbeiter(innen):
2

�ffnungszeiten:
Do 15.30-17.30 und nach Vereinbarung

Verkehrsverbindung:
Kurfürstenstraße (U1, 12, 15); Bülowstraße (U2)

Best�nde:
Allgemeine Geschäftsunterlagen (keine speziellen Geschäftsvorgänge): Geschäftsberichte und Bilanzen der Commerzbank 1913-2001, Mitarbeiterzeitschriften (1934-1944, 1976-1988), Telefon- und Unterschriftsverzeichnisse bis 1952, Bankgeschäftliche Formularbücher 1955-1969, Richtlinien für den Betrieb in den Geschäftsstellen 1938 und 1941, Satzungen der Commerzbank und Nachfolgeinstitute ab 1937 (bis Berliner Commerzbank 1983), Lohnsteuertabellen und Reichstarifordnung 1936/37, notarielle Protokolle der Hauptversammlung der Berliner Commerzbank 1958-1963.
Allgemeine Unterlagen: Unternehmens- und Unternehmerverzeichnisse, Fach- und Fachausbildungsliteratur zur Bank- und Finanzwirtschaft ab 1920, Gesetzessammlungen für die Geld- und Kreditwirtschaft 1933-1953, Börsenusancen, Kursblätter verschiedener Börsen zwischen 1930 und 1945.
Entwürfe und Ausführungen von Bankenwerbung, Festschriften verschiedener Banken (u. a. Commerzbank 1920, 1970 und 1995).
Darüber hinaus werden Geräte und Arbeitsmittel aus der Bankwirtschaft präsentiert sowie ein Überblick zur Entwicklung der deutschen Währung von 1872 bis 2002 gegeben. Über das Museum werden Anfragen an das Historische Archiv der Commerzbank in Frankfurt/Main weitergeleitet und bearbeitet.

Findmittel:
Bereitstellung auf Anfrage in Abstimmung mit den Mitarbeitern.

Ver�ffentlichungen:

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Bauhaus-Archiv Museum für Gestaltung

Name:
Bauhaus-Archiv Museum für Gestaltung

Kurzname:

Tr�gereinrichtung:
Bauhaus-Archiv e.V.

Strasse:
Klingelhöferstraße 14

Postleitzahl:
10785

Ort:
Berlin

Postanschrift:

Telefon:
(030) 2540020

Telefax:
(030) 25400210

E-Mail:
bauhaus@bauhaus.de

Homepage:
www.bauhaus.de

Leitung:
Dr. Annemarie Saeggi

Mitarbeiter(innen):
15

�ffnungszeiten:
Archiv und Bibliothek täglich 9.00-13.00

Verkehrsverbindung:
Nollendorfplatz (U1, 15, 2, 4); Lützowplatz (Bus 100, 129, 187, 341)

Best�nde:
Dokumentensammlung: Zu den zentralen Aufgaben des Bauhaus-Archivs gehört die Sammeltätigkeit aller auf das Ideengut des Bauhauses bezogenen Dokumente. Das Archiv verfügt über 500 Einzelbestände von Lehrern und Studierenden des Bauhauses und weitere zu Personen und Institutionen, die im Zusammenhang mit Ideen und Geschichte des Bauhauses stehen.
Gesammelt werden Briefe, Manuskripte, Druckschriften, sämtliche Publikationen des Bauhauses, Firmenschriften und Kataloge aus verschiedenen Bereichen der industriellen Gestaltung. Eine umfangreiche Zeitungsausschnittsammlung bietet eine Fülle an Informationen zur Rezeptionsgeschichte des Bauhauses. Den Grundstock der Dokumentensammlung bildet das Privatarchiv von Walter Gropius aus der Weimarer und Dessauer Zeit. Enthalten sind Materialien über die Vorgeschichte des Bauhauses und über seine Gründung, ein Teil der Sitzungsprotokolle des Meisterrats aus den Jahren 1919-1923 sowie Unterlagen, die den Schulalltag dokumentieren. Zahlreiche Manuskripte und eine umfangreiche Korrespondenz geben einen Einblick in Walter Gropius' intensive Tätigkeit am Weimarer und Dessauer Bauhaus.
Weitere wichtige Nachlässe sind: Georg Muche, Roman Clemens, Hans Thiemann, Philip Tolziner, Lucia Moholy, Adolf Behne und Hans Maria Wingler. Durch Spenden und Ankäufe wird das Material ständig ergänzt.
Sammlung künstlerischer Fotografie: Die Sammlung umfasst insgesamt etwa 5 000 Abzüge von Fotokünstlern aus dem Bauhaus und seinem Umkreis. Das größte Konvolut bildet der Nachlass von Lucia Moholy mit ihrer Dokumentation der Bauten und Produkte des Bauhauses. Weitere Bestände: Herbert Bayer, Marianne Brandt, Lyonel Feininger und Arbeiten seiner Söhne Andreas und T. Lux Feininger.
Fotoarchiv: Dieses einzigartige Bildarchiv zur Geschichte des Bauhauses, zu seinen Personen, Werkstätten und Produkten ist mittlerweile für die Forschung zu einem unverzichtbaren Partner geworden. Es enthält ca.
50 000 Fotos, Originale und Reproduktionen, sowie mehr als 1 500 Ektachrome. Zum Bestand gehören Porträtfotos, Aufnahmen von Arbeiten aus dem Unterricht wie aus den Werkstätten, von Architektur und Design des Bauhauses und schließlich Aufnahmen der Sammlungsgegenstände des Bauhaus-Archivs.
Hinzu kommen Dokumente zum Alltag am Bauhaus, zu den Werkstätten und Ateliers, zu den legendären Bauhausfesten, zur Bauhausbühne und zu Architektur und Ausstellungsdesign der zwanziger Jahre.

Findmittel:
Findbücher, Listen und Verzeichnisse.

Ver�ffentlichungen:
Adolf Meyer. Der zweite Mann. Ein Architekt im Schatten von Walter Gropius, hrsg. für das Bauhaus-Archiv von Annemarie Jaeggi, Berlin 1994; Muche, Georg. Ausstellungskatalog und Verzeichnis der Briefe Muches 1945-1984, Berlin 1992; Magdalena Droste: Bauhaus 1919-1933, hrsg. vom Bauhaus-Archiv Berlin, Köln 1990; Das frühe Bauhaus und Johannes Itten. Ausstellungskatalog, hrsg. für das Bauhaus-Archiv Berlin, Kunstsammlungen zu Weimar, Kunstmuseum Bern von Rolf Bothe, Peter Hahn und Hans Christoph von Tavel, Berlin 1994; Lucia Moholy. Bauhausfotografin, mit Texten, Briefen und Dokumenten, hrsg. vom Museumspädagogischen Dienst und dem Bauhaus-Archiv, Berlin 1995; Bauhaus in Berlin - Bauten und Projekte, hrsg. vom Bauhaus-Archiv, Berlin 1995; Bauhaus Weimar 1919-1924, Berlin 1996; Die Metallwerkstatt am Bauhaus. Ausstellungskatalog, hrsg. für das Bauhaus-Archiv von Klaus Weber, Berlin 1992; Bauhaus-Archiv Berlin: Museum für Gestaltung, die Sammlung, Hrsg.: Bauhaus-Archiv, Museumspädagogischer Dienst Berlin, Berlin 1999; Mehr als der bloße Zweck. Mies van der Rohe am Bauhaus 1930-1933, Hrsg.: Bauhaus-Archiv Berlin, Berlin 2001; Bauhaus-Möbel, eine Legende wird besichtigt, Hrsg. Bauhaus-Archiv Berlin, Berlin 2002.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Berlin-Brandenburgische Mühlenregistratur
Mühlen- und Mühlenbauarchiv für Berlin-Brandenburg

Name:
Berlin-Brandenburgische Mühlenregistratur
Mühlen- und Mühlenbauarchiv für Berlin-Brandenburg

Kurzname:

Tr�gereinrichtung:
Mühlenverein Berlin-Marzahn e.V. und Mühlenvereinigung Berlin-Brandenburg e.V.

Strasse:
Alt-Marzahn 63

Postleitzahl:
12685

Ort:
Berlin

Postanschrift:

Telefon:
(030) 5458995

Telefax:
(030) 5458995

E-Mail:
muehlenwolf@t-online.de

Homepage:
www.muehlenvereine-online.de; www.bwmbm.de

Leitung:
Jürgen Wolf

Mitarbeiter(innen):

�ffnungszeiten:
nach Vereinbarung

Verkehrsverbindung:
Springpfuhl (S7, 75); Alt-Marzahn (Tram 8, 18)

Best�nde:
Datenbank und Handakten zu ca. 850 Mühlenstandorten in Berlin und Brandenburg, 110 Glasnegative mit Abschlussarbeiten von Absolventen der Deutschen Müllerschule Dippoldiswalde ( um 1900); Sammlung von Katalogen deutscher Mühlenbauanstalten (Originale und Datenbank zur Benutzung bei der Analyse von Mühlenanlagen); 50 ausführliche müllereitechnische Dokumentationen nach dem "System Marzahn" (System zur Analyse, theoretischen Rekonstruktion und historisch korrekten Umnutzung von Mühlen); Sammlung von Mühlenbau- und Müllereifachbüchern sowie Mühlenbauzeichnungen (Privatsammlung Wolf); Sammlung verschiedener Lehrmittel für Müllerei und Mühlenbau (im Aufbau).

Findmittel:
Findbuch für die Mühlenstandorte.

Ver�ffentlichungen:
Historische Mühlen in Berlin und Brandenburg, hrsg. von der Mühlenvereinigung Berlin-Brandenburg e.V., 1999.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Berliner Missionswerk. Archiv

Name:
Berliner Missionswerk. Archiv

Kurzname:

Tr�gereinrichtung:

Strasse:
Bethaniendamm 29

Postleitzahl:
10997

Ort:
Berlin

Postanschrift:

Telefon:
(030) 2250450

Telefax:
(030) 22504510

E-Mail:
archiv@ekibb.de

Homepage:
www.bb-evangelisch.de

Leitung:
Dr. Wolfgang Krogel

Mitarbeiter(innen):
1

�ffnungszeiten:
Mo-Do 9.00-16.00, Fr 9.00-14.00

Verkehrsverbindung:
Kottbusser Tor (U); Ostbahnhof (S)

Best�nde:
Archivbestände des Berliner Missionswerks von den Anfängen 1824 ("Gesellschaft zur Beförderung der evangelischen Missionen unter den Heiden") bis 1976. Zu dem Bestand gehört eine umfangreiche Fotosammlung und eine Sammlung von Druckstöcken aus dem späten 19. und beginnenden 20. Jahrhundert.

Findmittel:
Ein nicht mehr aktuelles Findbuch der älteren Bestände. Die elektronische Neuverzeichnung des Gesamtbestandes steht kurz vor dem Abschluss.

Ver�ffentlichungen:

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Berliner Verkehrsbetriebe (BVG). BVG-Archiv

Name:
Berliner Verkehrsbetriebe (BVG). BVG-Archiv

Kurzname:

Tr�gereinrichtung:

Strasse:
Uferstraße 8-9

Postleitzahl:
13357

Ort:
Berlin

Postanschrift:
Potsdamer Straße 188, 10773 Berlin

Telefon:
(030) 25621721

Telefax:
(030) 25621722

E-Mail:

Homepage:

Leitung:
Hans-Jörg Wachtel

Mitarbeiter(innen):
1

�ffnungszeiten:
Benutzung kann auf Anfrage gestattet werden.

Verkehrsverbindung:
Pankstraße (U8); Nauener Platz (U9); Bus 143

Best�nde:
Berliner Verkehrsbetriebe (BVG) einschl. Vorläufergesellschaften ab 1873, ca. 50 lfm, enthält: Akten, Geschäftsberichte, Druckschriften, Fragen zum ÖPNV, betriebliche Mitteilungen bzw. Kundeninformationen, Dias, Fotos, Fachliteratur ÖPNV, Broschüren, Zeitschriften, Liniennetze, Fahrzeugmodelle.

Findmittel:

Ver�ffentlichungen:

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Berlinische Galerie. Künstler-Archive. Landesmuseum für Moderne Kunst, Fotografie und Architektur

Name:
Berlinische Galerie. Künstler-Archive. Landesmuseum für Moderne Kunst, Fotografie und Architektur

Kurzname:

Tr�gereinrichtung:

Strasse:
Alte Jakobstraße 124-128

Postleitzahl:
10969

Ort:
Berlin

Postanschrift:
Postfach 61 03 55, 10926 Berlin

Telefon:
(030) 78902-600

Telefax:
(030) 78902-700

E-Mail:
erler@berlinischegalerie.de

Homepage:
www.berlinischegalerie.de

Leitung:
Wolfgang Erler

Mitarbeiter(innen):
1

�ffnungszeiten:
Mo-Fr 9.00-16.00 (nur nach vorheriger Vereinbarung)

Verkehrsverbindung:

Best�nde:
Die Künstler-Archive sammeln Dokumente - Korrespondenzen, Manuskripte, Originalentwürfe, Ausstellungsunterlagen, Druckschriften, Zeitschriften, Bücher - von bildenden Künstlern und Kunstvermittlern, die zeitweise oder ständig in Berlin gelebt und gearbeitet haben. Zeitlich gesehen reichen die Archive von 1900 bis heute. Den Schwerpunkt bildet die klassische Moderne; das besondere Augenmerk gilt dabei denjenigen Künstlern, die im Nationalsozialismus als "entartet" galten und deren Werke in Vergessenheit gerieten.
Auswahl: Fidus, Naum Gabo, Raoul Hausmann, Hannah Höch, George Rickey, Fred Thieler, Hans Uhlmann; Galerie Ferdinand Moeller; Heinz Ohff, Eberhard Roters; 1 200 Einzeldossiers zu bildenden Künstlern.

Findmittel:
Findbücher, Verzeichnisse, Dateien.

Ver�ffentlichungen:
Hannah Höch. Eine Lebenscollage 1889-1978, hrsg. von der Berlinischen Galerie, bearb. von Cornelia Thater-Schulz, Ralf Burmeister, Eckhard Fürlus, Karin Hoerstel. Mit Essays von Eberhard Roters, Heinz Ohff, Ralf Burmeister, Eckhard Fürlus, Karoline Hille, Maria Makela und Eva Züchner, Berlin 1989; Scharfrichter der bürgerlichen Seele. Raoul Hausmann in Berlin 1900-1933, hrsg. und kommentiert von Eva Züchner, Ostfildern 1998; Kunst ist ein Spiel, das Ernst macht. Eberhard Roters: Briefe und Texte 1949-1994, hrsg. von Eva Züchner unter Mitarbeit von Hanna Roters, Köln 1999; Kurt Schwitters und Raoul Hausmann schreiben im Kino eine Oper, hrsg. und kommentiert von Eva Züchner, Berlin 2001; fmsbw: Blum spricht Hausmann, Schwitters, Williams. CD als Gemeinschaftsproduktion der Berlinischen Galerie und des Senders Freies Berlin; Hannah Höch. Album, hrsg. v. Gunda Luyken und Berlinische Galerie, Ostfildern 2004.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Bewag-Archiv

Name:
Bewag-Archiv

Kurzname:

Tr�gereinrichtung:
Bewag Aktiengesellschaft & Co. KG

Strasse:
Puschkinallee 52

Postleitzahl:
12435

Ort:
Berlin

Postanschrift:

Telefon:
(030) 26710412

Telefax:
(030) 26714665

E-Mail:
Hortmann.Susan@bewag.com

Homepage:
www.bewag.de

Leitung:
Susan Hortmann

Mitarbeiter(innen):
1

�ffnungszeiten:
nach Vereinbarung

Verkehrsverbindung:
Treptower Park (S4, 6, 8, 9, 10); Schlesisches Tor (U1, 15); Bus 265

Best�nde:
Der Bestand des Bewag-Archivs belegt die Geschichte des Berliner Energieversorgers Bewag und somit auch den Beginn der öffentlichen Elektrizitätsversorgung in Deutschland. Das Archiv verwahrt unternehmensrelevante Unterlagen, die seit Gründung der Bewag im Jahre 1884 als Aktiengesellschaft "Städtische Elektricitäts-Werke" (A.G.StEW) bis in die Gegenwart erzeugt wurden und erhalten geblieben sind. Hauptsächlich Akten der vor 1945 amtierenden Unternehmensleitungen gingen durch äußere Einwirkungen (Brand, Krieg) verloren. Der Bestand besteht folglich aus Akten der Unternehmensleitung ab 1945, Protokollen des Aufsichtsrates (überwiegend nach 1945), Gründungsunterlagen, betriebswirtschaftlichen und technischen Akten (ab 1884), Mitarbeiter-Veröffentlichungen (ab 1884), Plänen von Bewag-Objekten, Straßenplänen (Maßstab 1:250) mit Kabelverlauf zur Elektrifizierung Berlins (1905-1925), Grafiken, Filmen, Videos und Tonbändern. Seit der Wiedervereinigung der Bewag 1996 ist das Archiv um den Archiv-Bestand der Energieversorgung Berlin AG (früher "Energiekombinat Berlin"), der überwiegend Akten aus der Zeit 1945-1996 umfasst, reicher geworden.
Ein wichtiger Bestandteil des Archivs ist das Fotoarchiv mit ca. 35 000 Fotos, zurückreichend bis in die Anfänge elektrischer Anwendungs- und Energieerzeugungstechnik im 19. Jh. (z. B. Fotodokumentationen über den Bau und Betrieb Berliner Kraft- und Umspannwerke).
Die Archiv-Bibliothek beinhaltet Literatur über Berlin, Technikgeschichte sowie Fachzeitschriften zum Thema Energietechnik vom Beginn des 20. Jh., weiterhin interne und externe Festschriften, Kundenzeitschriften der BEW und AEG aus den Jahren 1905 ff. sowie wissenschaftliche Publikationen (Belegexemplare).

Findmittel:
Der Akten-Bestand ist elektronisch recherchierbar.

Ver�ffentlichungen:

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Bezirksmuseum Marzahn-Hellersdorf

Name:
Bezirksmuseum Marzahn-Hellersdorf

Kurzname:

Tr�gereinrichtung:
Bezirksamt Marzahn-Hellersdorf

Strasse:
Alt-Marzahn 51

Postleitzahl:
12685

Ort:
Berlin

Postanschrift:

Telefon:
(030) 54790921

Telefax:
(030) 54790920

E-Mail:
museum.marzahn-hellersdorf@t.-online.de

Homepage:

Leitung:
Dorothee Ifland

Mitarbeiter(innen):
3

�ffnungszeiten:
Archiv nach Vereinbarung

Verkehrsverbindung:
Springpfuhl (S7, 75); Alt-Marzahn (Tram 8, 18)

Best�nde:
Bibliothek, Dokumente, Fotos, Karten, Pläne, thematische Zeitungsauswertung, Lokalzeitungen

Findmittel:

Ver�ffentlichungen:

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Bibliothek für Bildungsgeschichtliche Forschung. Archiv

Name:
Bibliothek für Bildungsgeschichtliche Forschung. Archiv

Kurzname:

Tr�gereinrichtung:
Deutsches Institut für Internationale Pädagogische Forschung

Strasse:
Warschauer Straße 34-38

Postleitzahl:
10243

Ort:
Berlin

Postanschrift:
Postfach 171138, 10203 Berlin

Telefon:
(030) 29336027

Telefax:
(030) 29336025

E-Mail:
basikow@bbf.dipf.de

Homepage:
www.bbf.dipf.de

Leitung:
Dr. Ursula Basikow

Mitarbeiter(innen):
1

�ffnungszeiten:
Mo-Do 10.00-18.00, Fr 8.00-18.00, Anmeldung erbeten.

Verkehrsverbindung:
Warschauer Straße (S, U1, 15); Bus 142; Tram 20, 23

Best�nde:
Der Altbestand des Archivs geht zurück auf die Sammlungen der 1876 gegründeten Deutschen Lehrerbücherei mit einer Handschriftensammlung, darunter Briefe von Pestalozzi und Diesterweg sowie Überlieferungen von pädagogischen Verbänden wie dem Berliner Lehrerverein und dem Deutschen Lehrerverein. Die größte Bestandsgruppe bildet das Archiv der Akademie der Pädagogischen Wissenschaften der DDR (APW) als Depositum des Bundesarchivs. Dazu zählen neben dem Aktenbestand 50 Nachlässe von Pädagogen, u. a. der von Friedrich Fröbel und die von namhaften DDR-Pädagogen wie Robert Alt, Hans und Rosemarie Ahrbeck, Heinrich Deiters, Franz Hofmann, Gertrud Rosenow, Hans Siebert, Karl Sothmann, Marie Torhorst.
Seit Bestehen der BBF wird der Bestand des Archivs ständig erweitert, u. a. durch Personenfonds von DDR-Pädagogen wie Karl-Heinz Günther und zunehmend durch Nachlässe und Sammlungen aus den alten Bundesländern. Dazu zählen Sammlungen des Adolf-Reichwein-Archivs, die Nach- bzw. Vorlässe von Gottfried Hausmann, Rudolf Lochner, Berthold Otto, Hans Scheuerl sowie ein Teilnachlass von Elisabeth Blochmann. Übernommen werden konnten die Sammlungen des Instituts für Zeitgeschichtliche Jugendforschung (ZIJ) vorwiegend mit Materialien zur Geschichte der FDJ, der Gutachterstelle des Berliner Instituts für Lehrerfort- und -weiterbildung und Schulentwicklung (ehemals Auskunftsstelle für Schulwesen) mit Lehrerkarteien und Personalbögen von Volksschul- und Gymnasiallehrern Preußens, eine Sammlung von Schülerzeichnungen des Bundes Deutscher Kunsterzieher sowie Akten von nicht an staatliche Archive abgabepflichtige pädagogische Gesellschaften und Vereine wie die Unterlagen des Vorstandes der Deutschen Gesellschaft für Erziehungswissenschaft (DGfE) und einiger ihrer Sektionen sowie Aktenbestände des Pestalozzi-Fröbel-Verbandes und des Deutschen Instituts für Internationale Pädagogische Forschung (DIPF).

Findmittel:
Datenbanken, Findbücher, Karteien, Übergabelisten.

Ver�ffentlichungen:
Wege des Wissens. 125 Jahre Bibliothek für Bildungsgeschichtliche Forschung, hrsg. von Christian Ritzi und Gert Geißler, Berlin 2001; Verzeichnis bildungshistorisch relevanter Bestände in Archiven Berlins und des Landes Brandenburg, bearb. von Ursula Basikow (Bestandsverzeichnisse zur Bildungsgeschichte 8), Berlin 1999; Ursula Basikow, Sabine Harik: Adolf-Reichwein-Archiv erschlossen, in: Rundbrief der Sektion Historische Bildungsforschung der Deutschen Gesellschaft für Erziehungswissenschaft 9 (2000) 2, Dez., S. 46-49; Nachlässe, Autographen und Sammlungen als Quellen für die bildungsgeschichtliche Forschung : Bestandsverzeichnis des Archivs der Bibliothek für Bildungsgeschichtliche Forschung / [bearb. von: Ursula Basikow und Ilka Lenze]. - Red.-Schluss: Februar 2004, Berlin: Deutsches Institut für Internationale Pädagogische Forschung, 2004.- 81 S. (Bestandsverzeichnisse zur Bildungsgeschichte; 11).

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Bildarchiv Preußischer Kulturbesitz (Stiftung Preußischer Kulturbesitz)

Name:
Bildarchiv Preußischer Kulturbesitz (Stiftung Preußischer Kulturbesitz)

Kurzname:

Tr�gereinrichtung:

Strasse:
Märkisches Ufer 16-18

Postleitzahl:
10179

Ort:
Berlin

Postanschrift:

Telefon:
(030) 2787920

Telefax:
(030) 27879239

E-Mail:
bildarchiv@bpk.spk-berlin.de

Homepage:
www.bildarchiv-bpk.de

Leitung:
Hanns-Peter Frentz

Mitarbeiter(innen):
10

�ffnungszeiten:
Mo-Do 9.00-17.00, Fr 9.00-16.00

Verkehrsverbindung:
Märkisches Museum (U2); Bus 265

Best�nde:
Den Grundstock des Archivs bildet die "Sammlung Handke" (Schwerpunkt: 19. Jh.), die 1966 von der Staatsbibliothek Preußischer Kulturbesitz erworben wurde. Inzwischen hat sich das bpk zu einem Universalarchiv mit ca. 12 Millionen Abbildungsvorlagen aus allen Bereichen entwickelt. Darüber hinaus hat es Nachlässe bzw. Archive zahlreicher Fotografen wie Friedrich Seidenstücker (Weimar, Berlin), Josef Donderer (Varieté), Hanns Hubmann (Zeitgeschichte), Hilmar Pabel (Nachkriegs-Zeitgeschichte s/w), Charles Wilp (Kunst, Werbung), Benno Wundshammer (Zeitgeschichte), Willi Moegle (Design 1930-1970), Abisag Tüllmann (Porträts, Zeitgeschichte) und die Fotosammlungen zahlreicher DDR-Fotografen (Herbert Hensky, Max Ittenbach, Gerhard Kiesling, Jochen Moll, Horst E. Schulze et al.) und Bestände wie "Volk und Welt" (1933-1943) mit allen Rechten in sein "ruhendes Archiv" übernommen; zudem vertritt es die Nutzungsrechte von Dr. Ernst Salomon sowie von Aufnahmen zahlreicher anderer Fotografen. Des Weiteren besitzt es alte Fotografien, die wie seine Originale und Negative getrennt von den "Gebrauchsfotografien" (Barytabzüge 18x24 cm) aufbewahrt werden, die wiederum in vier Großbereiche unterteilt sind (Geschichte/Politik; Porträts; Schlagworte; Topographie). Schwerpunkte der Sammeltätigkeit: Kunst; politische, kulturelle und technische Entwicklung bis 1960 (Fotos, Stiche, Graphik, Lithographien, Farbdiapositive). Das Bildmaterial wird ständig ergänzt und betreut. Kooperationsvereinbarungen mit der Hamburger Kunsthalle (exklusive Vertretung der Bildrechte) und der Rèunion des Musées Nationaux, Paris (wechselseitige Vertretung der Bildrechte).

Findmittel:

Ver�ffentlichungen:
Roland Klemig: Das Bildarchiv, in: Mitteilungen der Staatsbibliothek Preußischer Kulturbesitz 4 (1972), H. 1, S. 1-6; ders.: Wie ordnet man 100 000 Bilder?, München 1982; bpk. (Hrsg.): Der faszinierende Augenblick. Fotografien von Friedrich Seidenstücker, Berlin 1987; bpk/Karl H. Pütz (Hrsg.): ... und abends in die Scala. Fotografien von Josef Donderer, Berlin 1991; Julius H. Schoeps/bpk (Hrsg.): Preußen. Geschichte eines Mythos, 2. Aufl., Berlin 2001; dies. (Hrsg.): Berlin. Geschichte einer Stadt, Berlin 2001; Manfred Görtemaker/bpk: Weimar in Berlin, Berlin 2002; Karl H. Pütz u. a.: Allein zum Thema Preußen ..., in: Börsenblatt 9 (2. 2. 1988), S. 362/3; ders.: Das Bildarchiv Preußischer Kulturbesitz, in: Dietmar Kerbs (Hrsg.): Wo sind die Fotos? Ein Führer zu Berliner Bildarchiven, Berlin (Das Bildarchiv, Nr. 3) 1991; ders.: Fotografieren und Fotografien für gewerbliche Zwecke in Museen, Rundbrief Fotografie, N.F. 3, S. 25-28 (Teil 1), N.F. 4, S. 27-30 (Teil 2), nachgedruckt in: Handreichungen für die Museumsarbeit, o. O., o. J. (Sächsische Landesstelle für Museumswesen, 1995), S. 25-43; ders.: Ownership and Protection of Intellectual Property Rights. Final Report and Recommendations of Working Group 3, Memorandum of Understanding, Brüssel 1998; ders.: Museen und Verwertungsgesellschaften, Rundbrief Fotografie N.F. 18 (1998), S. 44 f.; ders.: Bildagenturen und die Wahrnehmung von Rechten in der Informationsgesellschaft, in: Der Bildermarkt 1999, Berlin 1999, S. 147-155.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Brandenburgisches Landeshauptarchiv (BLHA)

Name:
Brandenburgisches Landeshauptarchiv (BLHA)

Kurzname:

Tr�gereinrichtung:
Ministerium für Wissenschaft, Forschung und Kultur des Landes Brandenburg

Strasse:
Zum Windmühlenberg

Postleitzahl:
14469

Ort:
Potsdam

Postanschrift:
Postfach 600449, 14404 Potsdam

Telefon:
(0331) 56740

Telefax:
(0331) 5674212

E-Mail:
poststelle@blha.brandenburg.de

Homepage:
www.landeshauptarchiv-brandenburg.de

Leitung:
Direktor: Dr. Klaus Neitmann

Mitarbeiter(innen):

�ffnungszeiten:
Mo, Di, Mi, Fr 8.30-17.00; Do 8.30-19.00; Freitag geschlossen

Verkehrsverbindung:
Bus 612, 692; Tram 92

Best�nde:
Das Brandenburgische Landeshauptarchiv ist nach dem Gesetz über die Sicherung und Nutzung von öffentlichem Archivgut im Land Brandenburg - Brandenburgisches Archivgesetz vom 7. April 1994 (GVBl I S. 94) das zentrale Archiv des Landes Brandenburg. Seine Zuständigkeit erstreckt sich auf das Archivgut aller Stellen des Landes Brandenburg und ihrer Rechts- und Funktionsvorgänger. Die Zuständigkeit umfasst auch das Archivgut von Reichs- und Bundesbehörden mit ausschließlich regionaler Zuständigkeit im Bereich des Landes Brandenburg. Das 1949 gegründete "Landesarchiv Brandenburg", ab 1951 "Brandenburgisches Landeshauptarchiv" (1965 bis 1990 "Staatsarchiv Potsdam") macht u. a. Urkunden, Amtsbücher, Akten, Karten und Plakate für die Erforschung der brandenburgischen Landes-, Regional-, Lokal- und Familiengeschichte zugänglich, die einen Zeitraum von nahezu 1 000 Jahren geschichtlicher Entwicklung umfassen. Seine vorrangige Aufgabe ist es, die in seiner Obhut befindlichen Unterlagen sicher zu verwahren und dauerhaft zu erhalten, sie durch benutzerfreundliche Findmittel allgemein nutzbar zu machen und auszuwerten. Zugleich ergänzt es seine Bestände ständig um die archivwürdigen Unterlagen, die in den Verwaltungen des Landes Brandenburg entbehrlich geworden sind.

regionale und örtliche Behörden und Einrichtungen der Kurmark, Neumark und Niederlausitz (12. Jh. bis 1815); zentrale, regionale und örtliche Behörden und Einrichtungen der preußischen Provinz Brandenburg sowie regionale und örtliche Behörden und Einrichtungen des Deutschen Reiches im Bereich dieser Provinz (1815 bis 1945); Behörden und Institutionen der brandenburgischen Justizverwaltung (1849 bis 1945), Zentrales Grundbucharchiv

zentrale, regionale und örtliche Behörden und Einrichtungen des Landes Brandenburg (1945 bis 1952); Staatsorgane und wirtschaftleitende Organe der Bezirke Cottbus, Frankfurt (Oder) und Potsdam sowie nachgeordnete Einrichtungen (1952 bis 1990); Parteien und gesellschaftliche Organisationen der Bezirke Cottbus, Frankfurt (Oder) und Potsdam (1945 bis 1989/90), Betriebe und Institutionen der Wirtschaft (1945 bis 1990); nachgeordnete Einrichtungen zentraler Organe der DDR (1945 bis 1990); Behörden und Einrichtungen des Landes Brandenburg (ab 1990)

Die seit dem 1. Januar 2001 dem Brandenburgischen Landeshauptarchiv angegliederte Landesfachstelle für Archive und öffentliche Bibliotheken berät die Unterhaltsträger der Archive und öffentlichen Bibliotheken sowie die Einrichtungen selbst in allen archivischen und bibliothekarischen Fachfragen. Sie unterstützt den Ausbau eines leistungsfähigen Netzes miteinander kooperierender Archive und öffentlicher Bibliotheken in den Landkreisen, kreisfreien Städten und allen anderen Kommunen. Die Landesfachstelle ist die zuständige Stelle für den Ausbildungsberuf der/des Fachangestellten für Medien- und Informationsdienste für den öffentlichen Dienst im Land Brandenburg.

Findmittel:
Findbücher, Findkarteien, Datenbanken

Ver�ffentlichungen:
Schriftenreihen des Archivs:
Veröffentlichungen des Brandenburgischen Landeshauptarchivs; Quellen, Findbücher und Inventare des Brandenburgischen Landeshauptarchivs; Bibliothek der Brandenburgischen und Preußischen Geschichte (gemeinsam mit der Historischen Kommission zu Berlin herausgegeben)
Periodika:
Jahrbuch für die Geschichte Mittel- und Ostdeutschlands (gemeinsam mit der Historischen Kommission zu Berlin herausgegeben); Brandenburgische Archive.Mitteilungen aus dem Archivwesen des Landes Brandenburg (in Zusammenarbeit mit dem VdA-Verband deutscher Archivarinnen und Archivare e. V., Landesverband Brandenburg).

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Brandenburgisches Landeshauptarchiv - Außenstelle Lübben

Name:
Brandenburgisches Landeshauptarchiv - Außenstelle Lübben

Kurzname:

Tr�gereinrichtung:
Ministerium für Wissenschaft, Forschung und Kultur des Landes Brandenburg

Strasse:
Reutergasse 12

Postleitzahl:
15907

Ort:
Lübben

Postanschrift:

Telefon:
(03546) 3160

Telefax:

E-Mail:

Homepage:

Leitung:
Direktor: Dr. Klaus Neitmann

Mitarbeiter(innen):

�ffnungszeiten:

Verkehrsverbindung:

Best�nde:
Das Brandenburgische Landeshauptarchiv ist nach dem Gesetz über die Sicherung und Nutzung von öffentlichem Archivgut im Land Brandenburg - Brandenburgisches Archivgesetz vom 7. April 1994 (GVBl I S. 94) das zentrale Archiv des Landes Brandenburg. Seine Zuständigkeit erstreckt sich auf das Archivgut aller Stellen des Landes Brandenburg und ihrer Rechts- und Funktionsvorgänger. Die Zuständigkeit umfasst auch das Archivgut von Reichs- und Bundesbehörden mit ausschließlich regionaler Zuständigkeit im Bereich des Landes Brandenburg. Das 1949 gegründete "Landesarchiv Brandenburg", ab 1951 "Brandenburgisches Landeshauptarchiv" (1965 bis 1990 "Staatsarchiv Potsdam") macht u. a. Urkunden, Amtsbücher, Akten, Karten und Plakate für die Erforschung der brandenburgischen Landes-, Regional-, Lokal- und Familiengeschichte zugänglich, die einen Zeitraum von nahezu 1 000 Jahren geschichtlicher Entwicklung umfassen. Seine vorrangige Aufgabe ist es, die in seiner Obhut befindlichen Unterlagen sicher zu verwahren und dauerhaft zu erhalten, sie durch benutzerfreundliche Findmittel allgemein nutzbar zu machen und auszuwerten. Zugleich ergänzt es seine Bestände ständig um die archivwürdigen Unterlagen, die in den Verwaltungen des Landes Brandenburg entbehrlich geworden sind.

regionale und örtliche Behörden und Einrichtungen der Kurmark, Neumark und Niederlausitz (12. Jh. bis 1815); zentrale, regionale und örtliche Behörden und Einrichtungen der preußischen Provinz Brandenburg sowie regionale und örtliche Behörden und Einrichtungen des Deutschen Reiches im Bereich dieser Provinz (1815 bis 1945); Behörden und Institutionen der brandenburgischen Justizverwaltung (1849 bis 1945), Zentrales Grundbucharchiv

zentrale, regionale und örtliche Behörden und Einrichtungen des Landes Brandenburg (1945 bis 1952); Staatsorgane und wirtschaftleitende Organe der Bezirke Cottbus, Frankfurt (Oder) und Potsdam sowie nachgeordnete Einrichtungen (1952 bis 1990); Parteien und gesellschaftliche Organisationen der Bezirke Cottbus, Frankfurt (Oder) und Potsdam (1945 bis 1989/90), Betriebe und Institutionen der Wirtschaft (1945 bis 1990); nachgeordnete Einrichtungen zentraler Organe der DDR (1945 bis 1990); Behörden und Einrichtungen des Landes Brandenburg (ab 1990)

Die seit dem 1. Januar 2001 dem Brandenburgischen Landeshauptarchiv angegliederte Landesfachstelle für Archive und öffentliche Bibliotheken berät die Unterhaltsträger der Archive und öffentlichen Bibliotheken sowie die Einrichtungen selbst in allen archivischen und bibliothekarischen Fachfragen. Sie unterstützt den Ausbau eines leistungsfähigen Netzes miteinander kooperierender Archive und öffentlicher Bibliotheken in den Landkreisen, kreisfreien Städten und allen anderen Kommunen. Die Landesfachstelle ist die zuständige Stelle für den Ausbildungsberuf der/des Fachangestellten für Medien- und Informationsdienste für den öffentlichen Dienst im Land Brandenburg.

Findmittel:
Findbücher, Findkarteien, Datenbanken

Ver�ffentlichungen:
Schriftenreihen des Archivs:
Veröffentlichungen des Brandenburgischen Landeshauptarchivs; Quellen, Findbücher und Inventare des Brandenburgischen Landeshauptarchivs; Bibliothek der Brandenburgischen und Preußischen Geschichte (gemeinsam mit der Historischen Kommission zu Berlin herausgegeben)
Periodika:
Jahrbuch für die Geschichte Mittel- und Ostdeutschlands (gemeinsam mit der Historischen Kommission zu Berlin herausgegeben); Brandenburgische Archive.Mitteilungen aus dem Archivwesen des Landes Brandenburg (in Zusammenarbeit mit dem VdA-Verband deutscher Archivarinnen und Archivare e. V., Landesverband Brandenburg).

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Bundesamt für zentrale Dienste und offene Vermögensfragen
AfR - Archiv

Name:
Bundesamt für zentrale Dienste und offene Vermögensfragen
AfR - Archiv

Kurzname:

Tr�gereinrichtung:

Strasse:
DGZ-Ring 12

Postleitzahl:
13086

Ort:
Berlin

Postanschrift:
Postfach 305, 10107 Berlin

Telefon:
(030) 91608-1163 oder 0188-70301163 (Frau Bach), (030) 91608-1164 oder 01888-70301164 (Herr Baake)

Telefax:
(030) 916081629

E-Mail:
ellen.bach@badv.bund.de; hans-ulrich.baake@badv.bund.de

Homepage:
www.badv.bund.de

Leitung:
Ellen Bach, Hans-Ulrich Baake

Mitarbeiter(innen):
2

�ffnungszeiten:
Di und Do 9.00-11.30 und 12.30-15.30, sowie nach Vereinbarung

Verkehrsverbindung:

Best�nde:
Amt für den Rechtsschutz des Vermögens der DDR (AfR) (ca. 1966-1990).
Tresorverwaltung beim Ministerium der Finanzen der DDR (Teilbestand, 1952-1990, unvollständig).
Untersuchungsausschuss Freiheitlicher Juristen (Teilbestand).

Findmittel:
umfangreiche Karteien und Datenbanken.

Ver�ffentlichungen:

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Bundesarchiv. Dienststelle Berlin
mit den Abt. R (Reich), DDR, SAPMO (Stiftung Archiv der Parteien und Massenorganisationen der DDR im Bundesarchiv) einschl. Bibliothek in Lichterfelde, der Abt. FA (Filmarchiv) am Fehrbelliner Platz und der Außenstelle Hoppegarten (Zwischenarchiv)

Name:
Bundesarchiv. Dienststelle Berlin
mit den Abt. R (Reich), DDR, SAPMO (Stiftung Archiv der Parteien und Massenorganisationen der DDR im Bundesarchiv) einschl. Bibliothek in Lichterfelde, der Abt. FA (Filmarchiv) am Fehrbelliner Platz und der Außenstelle Hoppegarten (Zwischenarchiv)

Kurzname:

Tr�gereinrichtung:

Strasse:
Finckensteinallee 63, 12205 Berlin: Benutzersaal Archiv Abt. R, DDR und SAPMO und Lesesaal Bibliothek
Abt. FA: Fehrbelliner Platz 3, 10707 Berlin

Postleitzahl:

Ort:

Postanschrift:
Postfach 450569, 12175 Berlin
Abt. FA: Postfach 310667, 10636 Berlin

Telefon:
(01888) 77700

Telefax:
(01888) 7770111
Abt. FA: (01888) 7770999

E-Mail:
berlin@barch.bund.de
Abt. FA: filmarchiv@barch.bund.de

Homepage:
www.bundesarchiv.de

Leitung:
Direktorin beim Bundesarchiv: Dr. Angelika Menne-Haritz

Mitarbeiter(innen):
360

�ffnungszeiten:
Benutzersaal Lichterfelde: Mo-Do 8.00-19.00, Fr 8.00-16.00
Lesesaal Bibliothek Lichterfelde: Mo-Do 9.00-19.00, Fr 9.00-16.00
Benutzung Abt. FA: Mo-Do 9.00-15.30, Fr 9.00-14.00

Verkehrsverbindung:
Bundesarchiv (Bus 211); Abt. FA: Fehrbelliner Platz (U1, 7)

Best�nde:
Abteilung Reich: Zivile Zentralbehörden des Norddeutschen Bundes und des Deutschen Reiches; Parteien einschließlich Personalunterlagen der NSDAP (ehem. BDC); Nachlässe, archivische Sammlungen
Abteilung DDR: Zivile Zentralbehörden der Sowjetischen Besatzungszone und der Deutschen Demokratischen Republik; Nachlässe, archivische Sammlungen
Abteilung Filmarchiv: Dokumentar- und Spielfilme, Fotos, Filmplakate und weitere filmbegleitende Materialien wie Drehbücher und Zulassungsunterlagen
Stiftung Archiv der Parteien und Massenorganisationen der DDR im Bundesarchiv: Bestände des früheren Zentralen Parteiarchivs der SED (ZPA), des FDGB und der Massenorganisationen der DDR, Nachlässe von Funktionären, Bibliothek zur DDR mit 1,6 Mill. Bänden und Kernbestand aus dem früheren Institut für Marxismus-Leninismus (IML), der Zentralbibliothek der Gewerkschaften und den Massenorganisationen

Findmittel:
Für die Archivbestände: Online-Beständeübersicht und Online-Findbücher auf der Website: www.bundesarchiv.de, Publikationsfindbücher, Findbücher, Ablieferungslisten und Karteien. Für die Bibliothek: Alphabetische und Sachkataloge, voraussichtlich ab 2003 OPAC im KOBV. Für die Filmbestände: Datenbankanwendungen im Zusammenhang mit dem Film- und Fotobestand und der deutschen Filmografie, Titel-, Personen- und sachthematische Karteien, Findbücher.

Ver�ffentlichungen:
Das Bundesarchiv. Dienstleister für Forschung, Öffentlichkeit und Verwaltung, Koblenz 2002 (Broschüre zum 50jährigen Bestehen des Bundesarchivs); Kabinettsprotokolle Bd. 11: Die Kabinettsprotokolle 1958, bearb. von Ulrich Enders und Christoph Schawe unter Mitwirkung von Ralf Behrendt, Josef Henke und Uta Rössel, München 2002; Kabinettsausschuß für Wirtschaft, Bd. 3: 1956-1957, bearb. von Ralf Behrendt und Uta Rössel, München 2001; Mitteilungen aus dem Bundesarchiv, Themenheft Filmarchiv 1 - 2000; CD-ROM "Die deutschen Filme", u. a. "Die TOP 100".

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Bundesbildstelle im Presse- und Informationsamt der Bundesregierung (BPA)

Name:
Bundesbildstelle im Presse- und Informationsamt der Bundesregierung (BPA)

Kurzname:

Tr�gereinrichtung:

Strasse:
Dorotheenstraße 84

Postleitzahl:
10117

Ort:
Berlin

Postanschrift:
11044 Berlin

Telefon:
(01888) 2722330

Telefax:
(01888) 2722305

E-Mail:
403@bpa.bund.de

Homepage:
www.bundesregierung.de

Leitung:
Arvid Brunnemann

Mitarbeiter(innen):
17

�ffnungszeiten:
Mo-Do 8.00-16.00, Fr 8.00-14.00

Verkehrsverbindung:
Friedrichstraße (RE, S, U6)

Best�nde:
Das Bildarchiv des Presse- und Informationsamtes der Bundesregierung umfasst ca. 2 000 000 Fotos. Das Archiv wird durch die Arbeit des Fotografen der BPA kontinuierlich erweitert. Ergänzt wird dieser Bestand durch den Ankauf bzw. die Übernahme einzelner Fotos oder ganzer Bildarchive, wie z. B. des Archivs von Georg Munker.
Es werden die politischen Aktivitäten des Bundespräsidenten, des Bundeskanzlers sowie der Bundesminister fotografisch dokumentiert und die dabei entstehenden Bilder für die Presse- und Öffentlichkeitsarbeit der Bundesregierung zur Verfügung gestellt. Im Jahr werden ca. 1 200 politische Ereignisse wie Staatsbesuche, Vertragsunterzeichnungen und Festakte aufgenommen.
Die Fotos werden auch für Veröffentlichungen Dritter bereitgestellt, zum Beispiel für Zeitungen, Zeitschriften, Verlage, Stiftungen und Institutionen. Für die Nutzung sind marktübliche Bildhonorare zu zahlen.

Findmittel:
Bilddatenbank, Kartei.

Ver�ffentlichungen:

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

carrousel Theater an der Parkaue - Kinder- und Jugendtheater des Landes Berlin

Name:
carrousel Theater an der Parkaue - Kinder- und Jugendtheater des Landes Berlin

Kurzname:

Tr�gereinrichtung:

Strasse:
Parkaue 29

Postleitzahl:
10367

Ort:
Berlin

Postanschrift:

Telefon:
(030) 5577520

Telefax:
(030) 55775222

E-Mail:
info@carrousel.de

Homepage:
www.carrousel.de

Leitung:
Intendant: Manuel Schöbel

Mitarbeiter(innen):

�ffnungszeiten:
grundsätzlich Mo-Fr 10.00-17.00 und 1 Stunde vor Vorstellungsbeginn

Verkehrsverbindung:
Frankfurter Allee (S4, 8, 85, U5)

Best�nde:
Stückakten, Fotos, Videos, Protokolle, Plakate, sonstige Veröffentlichungen über die Inszenierungen, Gastspiele, sonstige Veranstaltungen und die sonstige Arbeit (z. B. Theaterpädagogik) des Theaters, seit der Gründung 1950 als "Theater der Freundschaft".

Findmittel:
Geordnet nach Titeln der Inszenierungen in chronologischer Reihenfolge in Ordnern.

Ver�ffentlichungen:
Kinder- und Jugendtheater in Berlin, hrsg. von Wolfgang Schneider, Frankfurt/Main 2000; Carrousel Theater an der Parkaue Berlin-Lichtenberg, in: Der historische Ort, Nr. 108; Jahrbücher des Europ. Projekts "Magic Net".

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Chronik Pankow

Name:
Chronik Pankow

Kurzname:

Tr�gereinrichtung:
Bezirksamt Pankow von Berlin, Kulturamt Pankow

Strasse:
Breite Straße 43

Postleitzahl:
13187

Ort:
Berlin

Postanschrift:

Telefon:
(030) 4814047

Telefax:
(030) 4814047

E-Mail:

Homepage:
www.kulturamt.prenzlberg.de

Leitung:
Barbara Goldstein, Lars-Holger Thümmler

Mitarbeiter(innen):
2

�ffnungszeiten:
Mo 8.00-16.00, Mi 14.00-19.00

Verkehrsverbindung:
Pankow (S und U); Tram 50, 52, 53

Best�nde:
Fotobestand: ca. 25 000 (1900 bis Gegenwart), 150 Glasplatten aus der Werkstatt Max Skladanowsky, 800 Dias (v. a. um 1925, aus Bildstelle Pankow übernommen); Kartenbestand: ca. 250; Aktenbestand: u. a. Bestände aus Buchholzer Lederfabrik, aus der Abteilung Kultur Fragmente aus persönlichen Nachlässen, Chroniken der Ortsteile, Manuskripte zur Regionalgeschichte; Zeitungsarchiv (seit 1945).

Findmittel:
Kartei, computergestützt.

Ver�ffentlichungen:

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Der Tagesspiegel. Recherche/Dokumentation

Name:
Der Tagesspiegel. Recherche/Dokumentation

Kurzname:

Tr�gereinrichtung:

Strasse:
Potsdamer Straße 77-87

Postleitzahl:
10785

Ort:
Berlin

Postanschrift:
10876 Berlin

Telefon:
(030) 26009240

Telefax:
(030) 26009648

E-Mail:
recherche@tagesspiegel.de

Homepage:
www.tagesspiegel.de

Leitung:
Thomas Friederich, (030) 26009286

Mitarbeiter(innen):
7

�ffnungszeiten:
Telefonische Aufträge werden an Werktagen angenommen. Lieferung gegen Rechnung. Die Dokumentation selbst ist nicht öffentlich.

Verkehrsverbindung:
Kurfürstenstraße (U1, 15); Bülowstraße (U2)

Best�nde:
Konventionelle Zeitungsausschnittsammlung "Der Tagesspiegel" 1945 bis 1993. Gebundene Exemplare 1945 ff. Vollständiger redaktioneller Teil ab 10/1993 im Volltext, ab 11/1996 zusätzlich inhaltlich erschlossen, zugänglich unter www.genios.de. Dort auch Übersicht über Nutzungsbedingungen und -gebühren.

Findmittel:
Monohierarchische Klassifikation 1945-1993. Ab 11/1996 Indexierung der online zugänglichen Volltexte.

Ver�ffentlichungen:

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Deutsche Dienststelle (WASt)

Name:
Deutsche Dienststelle (WASt)

Kurzname:

Tr�gereinrichtung:

Strasse:
Eichborndamm 179

Postleitzahl:
13403

Ort:
Berlin

Postanschrift:

Telefon:
(030) 419040

Telefax:
(030) 41904100

E-Mail:
wast@com-de.com

Homepage:
www.com-de.com/wast

Leitung:
Urs Veit

Mitarbeiter(innen):
394

�ffnungszeiten:
Mo-Mi 9.00-14.00, Do 10.00-18.00, Fr 9.00-13.00

Verkehrsverbindung:
Eichborndamm (S25); Rathaus Reinickendorf (U8); Bus 125, 221

Best�nde:
Personalunterlagen, Karteien und Sammelunterlagen über Angehörige des Heeres, der Luftwaffe und der Marine (1. und 2. Weltkrieg), sowie über westalliierte Kriegsgefangene, Truppenverlust- und Lazarettmeldungen, Gräberlisten, Versorgungsakten, Wehrstammbücher, Stalag-Karteien u. v. m.
Aufgrund des Datenschutzgesetzes erteilt die Deutsche Dienststelle (WASt) Auskünfte nur an Betroffene selbst, deren Angehörige und Rechtsnachfolger; Drittpersonen müssen eine Vollmacht vorlegen (Ausnahme: Sozialversicherungsträger und Behörden).

Findmittel:

Ver�ffentlichungen:
Arbeitsberichte; "60 Jahre im Namen des Völkerrechts" - die Deutsche Dienststelle (WASt) 1939-1999.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Deutsches Archäologisches Institut. Zentrale

Name:
Deutsches Archäologisches Institut. Zentrale

Kurzname:

Tr�gereinrichtung:
Bundesrepublik Deutschland, Auswärtiges Amt

Strasse:
Podbielskiallee 69-71

Postleitzahl:
14195

Ort:
Berlin

Postanschrift:
Postfach 330014, 14191 Berlin

Telefon:
(01888) 77110

Telefax:
(01888) 7711191

E-Mail:
archiv@dainst.de

Homepage:
www.dainst.de/Abteilungen/Zentrale Berlin/Archiv

Leitung:
Dr. Antje Krug

Mitarbeiter(innen):

�ffnungszeiten:
nach Terminabsprache, während der Dienstzeit (Mo-Do 8.00-16.30, Fr 8.00-15.00)

Verkehrsverbindung:
Podbielskiallee (U1); Bus 101, 148

Best�nde:
Nachlässe und Briefe von Archäologen und anderen Altertumswissenschaftlern. Ausgehend von Briefsammlungen etwa seit 1900 wurden Gelehrtennachlässe, Briefe, Wissenschaftsmaterialien, Grabungsdokumentationen u. a. aufgenommen, auch künstlerische Nachlässe (Walter Andrae). Dazu kommen Akten und Biographica der Korrespondierenden und Ordentlichen Mitglieder des Instituts (Zugang nur mit Genehmigung).

Findmittel:
Verzeichnisse der Nachlässe und Briefautoren (s. Homepage), Regesten der Briefsammlungen, detaillierte Verzeichnisse größerer Nachlässe.

Ver�ffentlichungen:
Hertha Simon: Gelehrtenbriefe im Archiv des DAI, Berlin 1973; Deutsches Archäologisches Institut (Hrsg.): Das Deutsche Archäologische Institut. Geschichte und Dokumente, Mainz 1979 ff.; Klaus Junker: Das Archäologische Institut des Deutschen Reiches zwischen Forschung und Politik. Die Jahre 1929 bis 1945, Mainz 1997.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Deutsches Historisches Museum. Sammlung historischer Dokumente, Hausarchiv, Bildarchiv und Bibliothek

Name:
Deutsches Historisches Museum. Sammlung historischer Dokumente, Hausarchiv, Bildarchiv und Bibliothek

Kurzname:

Tr�gereinrichtung:

Strasse:
Unter den Linden 2

Postleitzahl:
10117

Ort:
Berlin

Postanschrift:

Telefon:
(030) 203040

Telefax:
(030) 20304543

E-Mail:
webadmin@dhm.de

Homepage:
www.dhm.de

Leitung:
Dr. Dieter Vorsteher
Ansprechpartner:
Sammlung Dokumente I: Heidemarie Anderlik
Sammlung Dokumente II: Dr. Burkhard Asmuss
Hausarchiv: Birgit Schnabel
Bildarchiv: Dr. Dieter Vorsteher
Bibliothek: Regine Bleiß

Mitarbeiter(innen):

�ffnungszeiten:
Bibliothek und Bildarchiv: Mo-Fr 9.00-16.30, Sammlungen: nach Vereinbarung

Verkehrsverbindung:
Hackescher Markt (S3, 7, 75, 9); Bus 100, 200, 348

Best�nde:
Sammlung Dokumente I: 35 000 gedruckte und handschriftliche Zeugnisse der Alltags-, Herrschafts- und Wirtschaftsgeschichte bis zum Jahr 1914;
Sammlung Dokumente II: 150 000 Objekte vom Beginn des Ersten Weltkrieges bis zur Gegenwart, welche die Geschichte der Weimarer Republik, des Dritten Reichs, der DDR und der BRD dokumentieren;
Hausarchiv: Schriftgut der Zeughaus-Verwaltung (1806-1945), interimistische Zeughaus-Verwaltung (1945-1951), Archiv des Museums für deutsche Geschichte (1952-1990), Fotografische Dokumentation der Ausstellungen des MfdG, Archiv des Deutschen Historischen Museums (seit 1987);
Bildarchiv: Fotografische Dokumentation der Sammlungsbestände, Bildarchiv des ehemaligen Museums für Deutsche Geschichte sowie Archive von Fotografen.

Findmittel:
Kataloge und Datenbank. Bibliothek: 210 000 Bde., davon in Sondersammlungen 40 000 Zeitschriften, Zeitungen, Almanache, Jahrbücher, 10 000 Rara, 5 000 Militaria (Waffen- und Uniformkunde), 10 000 Museums- und Ausstellungskataloge. Wissenschaftliche Spezialbibliothek zur deutschen Geschichte.

Ver�ffentlichungen:

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Deutsches Musikarchiv Berlin

Name:
Deutsches Musikarchiv Berlin

Kurzname:

Tr�gereinrichtung:
Die Deutsche Bibliothek, Frankfurt am Main

Strasse:
Gärtnerstraße 25-32

Postleitzahl:
12207

Ort:
Berlin

Postanschrift:

Telefon:
(030) 770020

Telefax:
(030) 77002299

E-Mail:
info@dma.ddb.de

Homepage:
www.ddb.de

Leitung:
Dr. Ingo Kolasa

Mitarbeiter(innen):
45

�ffnungszeiten:
Mo-Do 9.00-15.00, Fr 9.00-14.00 und nach Vereinbarung

Verkehrsverbindung:
Bus 186

Best�nde:
Das Deutsche Musikarchiv Berlin ist die zentrale Sammlung von Musikalien und Tonträgern und das musikbibliographische Informationszentrum in Deutschland. 1970 gegründet setzt es die Tätigkeit der von der Phonographischen Industrie 1961 mit ins Leben gerufenen Deutschen Musik-Phonothek fort. Bei einem Bestand von über einer Million Bestandseinheiten sammelte das Deutsche Musikarchiv bisher über 591 000 moderne (DVDs, CDs, LPs, Singles, Kompaktkassetten, Musikvideos) und über 180 000 historische Tonträger (Schellackplatten, Klavierrollen, Walzen). Mit der Übernahme des GEMA-Archivs im Jahr 2000 sind im Deutschen Musikarchiv nun insgesamt 449 000 Noten vorhanden, die kontinuierlich rückwirkend bis 1945 gesammelt werden. Eine Handbibliothek mit Spezialbeständen zum Bereich Musik von 35 000 Büchern, CD-ROMs und Mikrofiches rundet die Sammlung im Musikarchiv ab. Das Musikinformationszentrum des Verbandes der Komponisten und Musikwissenschaftler der DDR, das 1991 vom Deutschen Musikarchiv Berlin übernommen wurde, dokumentiert das zeitgenössische Musikleben der ehemaligen DDR.

Findmittel:
Internet-Katalog unter www.ddb.de: Bestände ab 1984; CD-ROM DNB-Musik: Bestände ab 1976, Katalog der historischen Tonträger, Datenbank der Musikliteratur ab 1982, Bonner Katalog (Verzeichnis der Leihmateriale); Gedruckter Phonothekskatalog: Bestände vor 1970; Karteien des ehemaligen Musikinformationszentrums des Verbandes der Komponisten und Musikwissenschaftler der DDR.

Ver�ffentlichungen:

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Deutsches Rundfunkarchiv Wiesbaden - Potsdam - Babelsberg. Standort Babelsberg

Name:
Deutsches Rundfunkarchiv Wiesbaden - Potsdam - Babelsberg. Standort Babelsberg

Kurzname:

Tr�gereinrichtung:

Strasse:
Marlene-Dietrich-Allee 20

Postleitzahl:
14482

Ort:
Potsdam-Babelsberg

Postanschrift:

Telefon:
(0331) 58120

Telefax:
(0331) 5812199

E-Mail:
sekretariat@dra.de

Homepage:
www.dra.de

Leitung:
Dr. Peter-Paul Schneider

Mitarbeiter(innen):
55

�ffnungszeiten:
Mo-Do 8.00-16.00, Fr 8.00-14.30

Verkehrsverbindung:
Griebnitzsee (S7)

Best�nde:
Der Babelsberger Standort des Deutschen Rundfunkarchivs sammelt, archiviert und erschließt Ton- und Bildträger sowie Schriftgut von Hörfunk und Fernsehen der DDR.
Der Hörfunkbestand gliedert sich in den Wort- und Musikbereich und umfasst die Überlieferung der Rundfunk- und Fernsehmusikproduktionen des Funkhauses Berlin und des Deutschen Fernsehfunks/Fernsehen der DDR aus dem Zeitraum 1945 bis 1991 auf 300 000 Musik- und 150 000 Worttonträgern.
Der Archivbestand Fernsehen umfasst alle Eigen-, Co- und Auftragsproduktionen des Deutschen Fernsehfunks/Fernsehen der DDR. Die Bestände erstrecken sich zeitlich von der ersten Sendung am 21.12.1952 bis zur Einstellung des Sendebetriebes am 31.12.1991. Sie enthalten insgesamt ca. 100 000 Titel mit z. T. mehreren Beiträgen und ca. 60 000 Sujets.
Die Schriftgutbestände umfassen gegenwärtig insgesamt ca. 7 300 lfm Aktenüberlieferung, bestehend aus Verwaltungs- und Programmschriftgut von DDR-Hörfunk und -Fernsehen sowie der ehemaligen Bezirkssender der DDR. Mit der Eingliederung der historischen Archive des Sender Freies Berlin und des RIAS (als Teil des heutigen DeutschlandRadio) konnten gleichsam auch zwei West-Berliner Überlieferungen im DRA angesiedelt werden.
Der Bestand des Bildarchivs umfasst die Jahre 1945 bis 1991 und dokumentiert sich in verschiedensten Bildträgern: 260 000 Fotos, 2,3 Millionen Negative, Kontaktabzüge und 70 000 Dias. Ein Konvolut von ca. 2 000 Programmheften zu Filmen der Ufa, DEFA und ausländischen Produktionen ergänzen diesen Bestand.
Die breit gefächerte Presseausschnitt-Sammlung des früheren DDR-Hörfunks und -Fernsehens steht im Pressearchiv als historische Quellensammlung, aber auch als Informationspool zur Rundfunk- und Zeitgeschichte zur Verfügung. Ein umfangreicher biografischer Teil enthält Dossiers zu Künstlern, Politikern und anderen Personen der Zeitgeschichte, nicht nur der DDR. Sammelschwerpunkte der etwa 12 000 Bände umfassenden Präsenzbibliothek sind rundfunkgeschichtliche Themen, besonders zur Rundfunkgeschichte der DDR. Daneben sind die Zeitschriftensammlung, die Sammlung wissenschaftlicher Arbeiten sowie der Bestand an Eigenpublikationen von Bedeutung.
Die Gerätesammlung des Deutschen Rundfunkmuseums, die der Trägerverein Deutsches Rundfunkmuseum nach Schließung des Museums auf dem Berliner Messegelände unterm Funkturm dem DRA übereignet hat, umfasst Rundfunkgeräte vom Röhren- und Detektorempfänger der 1920er Jahre bis hin zur Hifi-Stereoanlage und Weltempfänger der 1990er Jahre, ebenso Fernsehgeräte von den Anfängen der Fernsehzeit mit der Nipkowscheibe bis zum Farbfernseher mit Stereotechnik sowie Geräten der Studiotechnik.

Findmittel:
Zur Recherche stehen neben den überlieferten Karteikartenkatalogen auch Bestands- und Informationsdatenbanken zur Verfügung. Recherchiert werden mit folgenden Schwerpunkten:
- Datenbank zur Dokumentation des überlieferten Aktenbestandes von Hörfunk und Fernsehen der DDR und der Schriftgutbestände des Sender Freies Berlin und des RIAS Berlin,
- Datenbank zur Dokumentation des Bibliotheksbestandes und der Sammlung von Publikationen des Hörfunks und des Fernsehens der DDR sowie des RIAS Berlin,
- Datenbank zur Dokumentation von Ereignissen mit dem Schwerpunkt DDR-Geschichte,
- Datenbank zur Dokumentation von Sendungen des Fernsehens der DDR,
- Online-Nutzung der Wort-Musik-Datenbank ZWM zur Dokumentation des Hörfunkbestandes Wort und Musik.
Als Digitales Textarchiv sind im Intranet der Korrigierte Sendeplan des DDR-Fernsehens (1952-1991) und im Internet Manuskripte und Begleitmaterialien der Sendung "Der Schwarze Kanal" (1960-1989) abrufbar.

Ver�ffentlichungen:
Literaturverfilmungen des Deutschen Fernsehfunks 1952-1991, zusammengestellt von Sigrid Ritter, hrsg. v. Deutschen Rundfunkarchiv, Frankfurt a. M., Berlin 1994; "Hier spricht Berlin...". Der Neubeginn des Rundfunks in Berlin 1945 (= Veröffentlichungen des Deutschen Rundfunkarchivs, Bd. 1), Potsdam 1995; Fernsehen für Kinder. Ein Bestandsverzeichnis (= Veröffentlichungen des Deutschen Rundfunkarchivs, Bd. 2), Potsdam 1995; Inventar der Manuskriptbestände des Berliner Rundfunks (1945-1950), zusammengestellt und bearb. von Alexander Greguletz (= Veröffentlichungen des Deutschen Rundfunkarchivs, Bd. 24), Potsdam 1999; Petra Galle/Axel Schuster: Archiv- und Sammlungsgut des RIAS Berlin. Ein Findbuch zum Bestand im Deutschen Rundfunkarchiv (= Veröffentlichungen des Deutschen Rundfunkarchivs, Bd. 31), Potsdam 2000; Das Schriftgut des DDR-Fernsehens. Eine Bestandsübersicht, zusammengestellt und bearb. von Sabine Salhoff, mit einer Einführug von Jörg-Uwe Fischer, hrsg. v. Deutschen Rundfunkarchiv, Berlin 2001; Das Schriftgut des DDR-Hörfunks. Eine Bestandsübersicht, zusammengestellt und bearb. von Ingrid Pietrzynski unter Mitarbeit von Alexander Greguletz, hrsg. v. Deutschen Rundfunkarchiv, Berlin 2002; Woo-Seung Lee, Das Fernsehen im geteilten Deutschland (1952-1989). Ideologische Konkutrenz und programmliche Kooperation (= Veröffentlichung des Deutschen Rundfunkarchivs, Bd. 29), Potsdam 2003.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Deutsches Theater Berlin. Archiv und Bibliothek

Name:
Deutsches Theater Berlin. Archiv und Bibliothek

Kurzname:

Tr�gereinrichtung:
Land Berlin/Senatsverwaltung für Wissenschaft, Forschung und Kultur

Strasse:
Schumannstraße 13a

Postleitzahl:
10117

Ort:
Berlin

Postanschrift:
Postfach 040209, 10061 Berlin

Telefon:
(030) 28441394

Telefax:
(030) 2824117

E-Mail:
archiv@deutschestheater.de

Homepage:

Leitung:
Hans Rübesame

Mitarbeiter(innen):
1

�ffnungszeiten:
nach Vereinbarung

Verkehrsverbindung:
Friedrichstraße (S und U); Bus 147

Best�nde:
Bibliothek: 9 000 Bände; Archiv: Text- u. Rollenbücher seit 1850 (ca. 35 000), Theaterzettel, Programmhefte, Proben- und Vorstellungsbücher, Rezensionen/Kritiken, Plakate, Fotos, Schallplatten, Inszenierungsdokumentationen.

Findmittel:
Karteien, Verzeichnisse.

Ver�ffentlichungen:
Magazin des Deutschen Theaters (ab Spielzeit 2001/2002).

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Deutsches Zentralinstitut für soziale Fragen (DZI)

Name:
Deutsches Zentralinstitut für soziale Fragen (DZI)

Kurzname:

Tr�gereinrichtung:

Strasse:
Bernadottestraße 94

Postleitzahl:
14195

Ort:
Berlin

Postanschrift:

Telefon:
(030) 8390010, Bibliothek 83900113

Telefax:
(030) 8314750

E-Mail:
sozialinfo@dzi.de

Homepage:
www.dzi.de

Leitung:
Burkhard Wilke

Mitarbeiter(innen):
21

�ffnungszeiten:
Mo, Di 12.00-18.00, Mi, Do 9.00-15.00, Fr u. U. nach Vereinbarung

Verkehrsverbindung:
Podbielskiallee (U1); Bernadottestraße (Bus 110)

Best�nde:
Eine der umfassendsten deutschsprachigen Fachbibliotheken zur Sozialarbeit, Sozialpädagogik und Wohlfahrtspflege. Der Altbestand - Monographien und Fachzeitschriften - reicht zurück in das Jahr 1880. Seit 1945 neu aufgebaute ständige Sammlung von Fachzeitschriften, Grauer Literatur und ausgewählten Monographien. In der Abteilung Spenderberatung/Spenden-Siegel werden Materialien über Spendenorganisationen aus dem humanitär-karitativen Bereich gesammelt und Auskünfte erteilt.

Findmittel:
EDV-gestützte, kostenpflichtige Recherche in der Datenbank DZI-SoLit, OPAC, themengebundene Literaturlisten, DZI-Thesaurus; Altbestand: Karteikarten nach Verfassern und Systematik geordnet, weitere kleinere Datenbanken auf CD-ROM.
Datenbank im Internet: www.dzi.de/Literatur/DZISoLit.

Ver�ffentlichungen:
Fachzeitschrift "Soziale Arbeit", gegründet 1951, erscheint 11 x im Jahr; Schriftenreihe "Soziale Arbeit SPEZIAL"; Graubuch: Führer durch das soziale Berlin, als Buch und auf CD-ROM; "Von der Armenpflege zum Sozialstaat". Chronik des DZI, Berlin 1993; DZI Spenden-Siegel Bulletin; DZI Spenden-Almanach 2003/2004.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

DeutschlandRadio, Funkhaus Berlin, Ressort Dokumentation und Archive

Name:
DeutschlandRadio, Funkhaus Berlin, Ressort Dokumentation und Archive

Kurzname:

Tr�gereinrichtung:

Strasse:
Hans-Rosenthal-Platz

Postleitzahl:
10825

Ort:
Berlin

Postanschrift:

Telefon:
(030) 85035100

Telefax:
(030) 85035109

E-Mail:
martin.baumgaertel@dradio.de

Homepage:
www.dradio.de

Leitung:
Martin Baumgärtel

Mitarbeiter(innen):
25

�ffnungszeiten:
rundfunkinterne Benutzung; externe Nutzung in Sonderfällen nach Anmeldung und Absprache

Verkehrsverbindung:
Innsbrucker Platz (S1, 4, 45, 46); Bundesplatz (U9); Rathaus Schöneberg (U4)

Best�nde:
Tonbänder: Wort- und Musikproduktionen des RIAS und von DeutschlandRadio Berlin, Beiträge und Mitschnitte von Sendungen der ehemaligen DDR;
Schallplatten und CDs (Industrieproduktionen), Audiofiles (aktuelle Dokumentation);
Printdokumentation: Zeitungsausschnittsammlung, Bücher, Datenbanken und Internet;
Notenarchiv gemeinsam mit SFB und ROC GmbH.

Findmittel:
Kataloge und Karteien, diverse Datenbanken.

Ver�ffentlichungen:

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Die Bundesbeauftragte für die Unterlagen des Staatssicherheitsdienstes der ehemaligen Deutschen Demokratischen Republik (BStU)
Abteilung Archivbestände

Name:
Die Bundesbeauftragte für die Unterlagen des Staatssicherheitsdienstes der ehemaligen Deutschen Demokratischen Republik (BStU)
Abteilung Archivbestände

Kurzname:

Tr�gereinrichtung:

Strasse:
Ruschestr. 103

Postleitzahl:
10365

Ort:
Berlin

Postanschrift:

Telefon:
(030) 23246699

Telefax:
(030) 23246619

E-Mail:
post@bstu.bund.de; archivfuehrungen@bstu.bund.de

Homepage:
www.bstu.bund.de

Leitung:
Birgit Salamon

Mitarbeiter(innen):
292

�ffnungszeiten:
Öffnungszeiten: Der Zugang zur Abteilung Archivbestände ist nur im Rahmen von Archivführungen möglich. Öffentliche Führungen finden jeweils am 1. Dienstag im Monat von 17 - 19 Uhr statt. Anmeldung ist erwünscht. Die Antragstellung und Akteneinsicht erfolgen über die in der Karl-Liebknecht-Straße 31/33 (Nähe Alexanderplatz) befindliche Abteilung Auskunft (Abt. AU) der BStU; Öffnungszeit der Lesesäle Mo/Di/Do 8.30-16.30, Mi 8.30-19.00, Fr. 8.30-15.00; Grundlage für die Akteneinsicht ist das Stasi-Unterlagen-Gesetz (StUG) vom 21.12.1991.

Verkehrsverbindung:
Magdalenenstraße (U 5)

Best�nde:
In den Archiven der Bundesbeauftragten werden die Unterlagen verwahrt, die in den mehr als 40 Jahren der Existenz des Staatssicherheitsdienstes der ehemaligen DDR und seiner Vorgängerorganisationen in der damaligen sowjetischen Besatzungszone ab 1945 bis zur Jahreswende 1989/90 entstanden sind. Die schriftliche Überlieferung umfasst insgesamt über 111 000 lfm. Dazu gehören außerdem Sicherungs- und Arbeitsfilme, die, rückkopiert auf Papier, Schriftgut im Umfang von ca. 46 500 lfm ergäben.
Das Schriftgut besteht aus bereits vom Staatssicherheitsdienst archivierten Akten und dem überlieferten Schriftgut der Diensteinheiten, welches bis zuletzt in Gebrauch war und oft nicht als formierte Akten, sondern als lose Blattsammlungen vorliegt. Hinzu kommt teilweise mehrfach zerrissenes Schriftgut in ca. 15 500 Behältnissen (überwiegend Säcke), das in den letzten Wochen der Existenz des Ministeriums für Staatssicherheit (MfS) vernichtet werden sollte, dessen vollständige Zerstörung aber nicht mehr gelang. Außerdem gibt es zahlreiche audiovisuelle Datenträger wie Fotos, Dias, Videos, Kinofilme und Tonträger.
Die ministerielle Überlieferung im Umfang von ca. 42 700 lfm lagert im Archiv der Zentralstelle in Berlin. Hinzu kommen Sicherungs- und Arbeitsfilme, die, rückkopiert auf Papier, einen Umfang von ca. 26 600 lfm hätten. Die restlichen von den Bezirksverwaltungen des MfS angelegten Unterlagen befinden sich in den Archiven der Außenstellen der BStU in den ehemaligen DDR-Bezirkshauptstädten (ca. 69 200 lfm), wobei auch Ost-Berlin über eine eigene MfS-Bezirksverwaltung verfügte. Dieser letztgenannte Aktenbestand gelangte in die BStU-Außenstelle Berlin, die organisatorisch getrennt von der Zentralstelle im selben Gebäude untergebracht wurde (ca. 2268 lfm). Hier befindet sich seit 2009 ebenfalls der Bestand der Außenstelle Potsdam (4738 lfm).
Alle diese Unterlagen dokumentieren in vielfältiger Weise die Aufgaben des Staatssicherheitsdienstes, die er im Auftrag und mit Wissen der SED als politische Geheimpolizei, als geheimer Nachrichtendienst und als "Organ" für strafrechtliche Untersuchungen über vierzig Jahre mit immer stärker werdender Obsession wahrnahm.

Grundlage für die Tätigkeit der am Tag der Deutschen Wiedervereinigung, am 3. Oktober 1990, gegründeten Behörde des Bundesbeauftragten (in der Anfangszeit "Sonderbeauftragte") ist das Gesetz vom 20. Dezember 1991 über die Unterlagen des Staatssicherheitsdienstes der ehemaligen Deutschen Demokratischen Republik (StUG). Die sichere Aufbewahrung, Ordnung, Erschließung und Bereitstellung der Unterlagen in der Zentralstelle obliegt der Abteilung Archivbestände (Abteilung AR) der BStU. Ihre Hauptaufgabe ist die archivische Verzeichnung des Schriftgutes der Diensteinheiten, von dem bislang etwa 72% erschlossen wurde. BStU-weit, unter Einbeziehung der Außenstellen, sind 83% des Schriftgutes der Diensteinheiten erschlossen. Die bereits vom MfS archivierten Unterlagen sind nutzbar, soweit sich die Recherche in ihnen auf Personen bezieht.
Die wichtigsten Quellen für wissenschaftliche Recherchen aus dem breiten Spektrum der Überlieferung sind unter anderem:

Weitere aktuelle Angaben sind auf der Website der BStU zu finden.

Findmittel:
Die Erschließungsergebnisse werden im Wesentlichen mit BStU-internen Datenbanken, wie der Datenbank "Sachaktenerschließung", und zum Teil auch in Findbüchern festgehalten, von denen bisher drei vorliegen. Diese können auf der BStU-Website heruntergeladen werden. Daneben werden Aktenverzeichnisse im Internet bereitgestellt.
Eine besondere Rolle spielen die umfangreichen Möglichkeiten zur personenbezogenen Recherche: Soweit Personennamen bekannt sind, die mit dem Forschungsthema in Berührung stehen, insbesondere von Personen der Zeitgeschichte und von Amtsträgern, kann eine Personenrecherche in den Zentralkarteien des Staatssicherheitsdienstes und in den von Mitarbeitern der Bundesbeauftragten angelegten Findkarteien und Datenbanken erfolgen. Diese Recherchen können zu weiteren nutzbaren Unterlagen führen.
Die Bearbeitung eines Forschungsantrags ist in den §§ 32, 32a und 33 StUG geregelt, die die Verwendung der Unterlagen des Ministeriums für Staatssicherheit für die politische und historische Aufarbeitung beinhalten.

Ver�ffentlichungen:
Silvia Oberhack, Katrin Rübenstrunk: Die bewegten Bilder des ehemaligen Ministeriums für Staatssicherheit. Filme und Videos, in: Info 7 1/2010, S. 15-19; Abteilung Archivbestände (Hrsg.), Elisabeth Larssen, Jana Florczak (Bearb.): Vorläufiges Findbuch Sekretariate der Stellvertreter des Ministers Neiber, Mittig und Schwanitz im Ministerium der Staatssicherheit der DDR (=Archiv zur DDR-Staatssicherheit im Auftrag der Bundesbeauftragten für die Unterlagen des Staatssicherheitsdienstes der ehemaligen Deutschen Demokratischen Republik, Bd. 10), Münster 2008; Hansjörg Geiger (Begr.) u.a.: Stasi-Unterlagen-Gesetz. Kommentar, Stuttgart 2006; Die Bundesbeauftragte für die Unterlagen des Staatssicherheitsdienstes derehemaligen DDR, Außenstelle Potsdam (Hrsg.), Matthias Dießner (Bearb.): Übersicht über die Karteien des MfS in der Außenstelle Potsdam, Potsdam 2005; Die Bundesbeauftragte für die Unterlagen des Staatssicherheitdienstes der ehemaligen DDR (Hrsg.); Roger Engelmann, Frank Jostel (Bearb.): Grundsatzdokumente des MfS (=Anatomie der Staatssicherheit. Geschichte, Struktur und Methoden. MfS-Handbuch, V/5), Berlin 2004; Jochen Hecht: Die Stasi-Unterlagen als Quelle zur DDR-Geschichte, in: Siegfried Suckut, Jochen Weber (Hrsg.): Die Stasi-Akten zwischen Politik und Zeitgeschichte. Eine Zwischenbilanz, München 2003, S. 198-217; Birgit Salamon: Die Archive der Bundesbeauftragten für die Stasiunterlagen (BStU) - Die archivfachliche Arbeit an den MfS-Geheimdienstunterlagen - Fragen und Herausforderungen, in: Der Archivar, Jg. 55, 2002, H. 3, S. 203; Dagmar Unverhau: Zerreißen, vernichten, verlagern, verschwinden lassen – Die Aktenpolitik der SED-Staatssicherheit im Zeichen ihrer „Wende“ 1989, in: Archive und Herrschaft. Referate des 72. Deutschen Archivtages 2001 in Cottbus, Siegburg 2001, S. 174-210; Roger Engelmann: Zum Quellenwert der Unterlagen des Ministeriums für Staatssicherheit, in: Klaus-Dietmar Henke, Roger Engelmann: Aktenlage. Die Bedeutung der Unterlagen des Staatssicherheitsdienstes für die Zeitgeschichtsforschung, Berlin 1995.

Stand: Juli 2010

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

die tageszeitung (taz). Archiv und Dokumentation

Name:
die tageszeitung (taz). Archiv und Dokumentation

Kurzname:

Tr�gereinrichtung:

Strasse:
Kochstraße 18

Postleitzahl:
10969

Ort:
Berlin

Postanschrift:

Telefon:
(030) 25902204

Telefax:
(030) 25902102

E-Mail:
marquardt@taz.de

Homepage:
www.taz.de

Leitung:
Brigitte Marquardt

Mitarbeiter(innen):
6

�ffnungszeiten:
nach Vereinbarung

Verkehrsverbindung:
Kochstraße (U6)

Best�nde:
taz-Ausgaben komplett, taz-Journale, taz-Volltextdatenbank ab 1986.

Findmittel:
Ausschnittsammlung, Register, Notation.

Ver�ffentlichungen:

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Diözesanarchiv Berlin (DAB)

Name:
Diözesanarchiv Berlin (DAB)

Kurzname:

Tr�gereinrichtung:
Erzbistum Berlin/Erzbischöfliches Ordinariat Berlin

Strasse:
Bethaniendamm 29

Postleitzahl:
10997

Ort:
Berlin

Postanschrift:

Telefon:
(030) 22504580

Telefax:
(030) 22504583

E-Mail:
info@dioezesanarchiv-berlin.de

Homepage:
www.dioezesanarchiv-berlin.de

Leitung:
Dr. Gotthard Klein

Mitarbeiter(innen):
2

�ffnungszeiten:
nach Voranmeldung Di 9.00-15.00 und Do 10.00-16.00

Verkehrsverbindung:
Ostbahnhof (S); Kottbusser Tor (U 1, 3, 8); Bethaniendamm (Bus 140)

Best�nde:
a) Geschichte: Nach der Zäsur von Reformation und Säkularisation wurde erst im 18. Jahrhundert katholische Seelsorge in der preußisch-brandenburgischen Zentrallandschaft wieder zugelassen, so dass sich nur allmählich ein Diasporakatholizismus konstituieren konnte, der aber nach dem endgültigen Fortfall des streng gehandhabten landesherrlichen Summepiskopates dann im Gefolge der Ost-West-Migration während der Hochindustrialisierung ein atemberaubendes Wachstum erfuhr. Diese Aufwärtsentwicklung des Berliner Katholizismus in der Zeit vor und nach dem Ersten Weltkrieg führte 1930 zur Gründung eines eigenen Bistums. In der Nacht vom 23. zum 24. November 1943 wurde das Gebäude des Bischöflichen Ordinariats Berlin in der Behrenstraße 66 durch Kriegseinwirkung zerstört, Archiv und Registratur verbrannten vollständig. Erneute Kriegsverluste an Registraturgut erlitt das Bischöfliche Ordinariat im Ausweichquartier Michaelkirchstraße 3 am 2. Februar 1945. Damit war die zentrale archivische Überlieferung des Bistums Berlin und seiner Vorgängerinstitution - der Fürstbischöflichen Delegatur für Brandenburg und Pommern (1821-1929) - vernichtet. Nur die Akten des Hilfswerks beim Bischöflichen Ordinariat für die verfolgten katholischen "Nichtarier" haben den Krieg weitgehend unbeschadet überstanden und befinden sich heute im Diözesanarchiv, dessen Neuaufbau durch die allgemeinen Rahmenbedingungen erheblich erschwert wurde. Die politische Spaltung Berlins bedrohte die Einheit des Bistums und führte zu einer Aufgliederung der Verwaltung in zwei Ordinariate (1961-1990) mit je einem Generalvikar und auch je einem Archiv:
Das Archiv des Bistums Berlin (West) wurde 1966 (offiziell 1970) in Kellerräumen der Theologisch-Pädagogischen Akademie, Westendallee 54, errichtet und 1973 in das St.-Otto-Haus, Wundtstraße 48, verlegt. Wegen Raummangels fand das Archiv 1987 ein neues Domizil in Räumen des ehemaligen Franziskanerklosters, Götzstraße 65; seitdem führt es den Namen Diözesanarchiv. In Ost-Berlin wurde 1980 im Bernhard-Lichtenberg-Haus, Hinter der Katholischen Kirche 3, das Bistumsarchiv Berlin errichtet. Beide Archive konnten schließlich 1995 in den erweiterten Räumlichkeiten des Diözesanarchivs in Berlin-Tempelhof zusammengeführt werden. Seit 2005 befindet sich das Diözesanarchiv im Kirchlichen Archivzentrum Berlin, dem gemeinsamen Domizil von EZA (Evangelisches Zentralarchiv in Berlin), ELAB (Evangelisches Landeskirchliches Archiv in Berlin) und BMW (Archiv des Berliner Missionswerks).
b) Zuständigkeit: Das Diözesanarchiv verwaltet und erschließt das archivwürdige Schrift- und Bildgut der Einrichtungen des 1930 errichteten Bistums Berlin (seit 1994 Erzbistum) und sammelt Dokumentationsgut zur Geschichte der katholischen Kirche in Berlin, Brandenburg und Pommern. Rechtsgrundlage ist die Anordnung über die Sicherung und Nutzung der Archive der Katholischen Kirche (Amtsblatt des Bischöflichen Ordinariats Berlin 61, 1989, S. 9-11).
c) Tektonik: Abteilung I.: Bischöfliches Ordinariat Berlin (1945-1961), Bischöfliches Ordinariat Berlin (West) (1961-1990); Abteilung Ia.: Bischöfliches Ordinariat Berlin (Ost) (1961-1990); Abteilung II.: [Erz-]Bischöfliches Ordinariat Berlin (1990 ff.); Abteilung III.: Seelsorgsbezirke und Seelsorgestellen.
Die Kirchenbücher werden dezentral in den Seelsorgestellen der Erzdiözese geführt und verwahrt. Die während des Zweiten Weltkrieges teilweise ausgelagerten Kirchenbücher der östlich der Oder liegenden Pfarreien, die bis 1972 kanonisch zur Diözese Berlin gehörten, befinden sich gegenwärtig im Bischöflichen Zentralarchiv Regensburg (St.-Petersweg 11-13, 93047 Regensburg), das auf Wunsch gebührenpflichtige Auskunft erteilt. Als Ersatz-Kirchenbuchamt für die Heimatvertriebenen ist das Katholische Kirchenbuchamt (Kaiser-Friedrich-Straße 9, 53113 Bonn) tätig. Auskunft über den Verbleib der katholischen Militärkirchenbücher gibt das Archiv des Katholischen Militärbischofs (Am Weidendamm 2, 10117 Berlin).
Abteilung IV.: Kirchliche Institutionen und Organisationen; Abteilung V.: Nachlässe und kleine Erwerbungen; Abteilung VI.: Dokumentation zur Geschichte und Vorgeschichte der Erzdiözese Berlin; Abteilung VII.: Sonstiges Dokumentationsgut; Abteilung VIII.: Archivische Sammlungen und Selekte (ohne Bildmaterial); Abteilung IX.: Bildarchiv; Abteilung X.: Dienstbibliothek (Präsenzbestand: keine Ausleihe!).

Findmittel:

Ver�ffentlichungen:
(Auswahl): Amtsblatt des Bischöflichen Ordinariats Berlin 42 (1970), S. 23; ebd. 52 (1980), S. 84; Georg v. Glowczewski/Dieter Hanky: Mosaiksteinchen gesammelt. Einweihung des Diözesanarchivs in Tempelhof, in: Petrusblatt 12, 25. März 1990; Führer durch die Bistumsarchive der katholischen Kirche in Deutschland, 2. Aufl., Siegburg 1991, S. 79-81 u. 207 f.; Gotthard Klein: Diözesanarchiv, in: Der Archivar 45 (1992), Sp. 367 f.; Gotthard Klein: 25 Jahre Diözesanarchiv Berlin. Eine Zwischenbilanz, in: Wichmann-Jahrbuch des Diözesangeschichtsvereins Berlin, N. F. 2 = 32-33 (1992/93), S. 157-175; Werner Kerkloh: "Gedächtnis der Verwaltung und Tresor der Kirchengeschichte". Kardinal Sterzinsky weihte neue Räume des Diözesanarchivs in der Tempelhofer Götzstraße ein, in: Kath. Kirchenzeitung für das Erzbistum Berlin 40, 1. Oktober 1995; Peter Funk: Optimierung des bestehenden EDV-gestützten Bildarchivs im Diözesanarchiv Berlin, Zulassungsarbeit, Fachhochschule Potsdam, Institut für Information und Dokumentation, 1996; Esther Brown: und auch ein letzter Gruß von Honecker. Kranzschleifen, Totenmasken, ungewöhnliche Meßkelche - im Diözesanarchiv Berlin gibt es mehr als verstaubte Akten, in: Kath. Kirchenzeitung für das Erzbistum Berlin 48, 29. November 1998; Reimund Haas: Dr. Bernhard Stasiewski (1905-1995) und die Anfänge der Pfarrarchivpflege im Bistum Berlin (1936/7), in: Im Gedächtnis der Kirche neu erwachen. Studien zur Geschichte des Christentums in Mittel- und Osteuropa. Festgabe für Gabriel Adriányi zum 65. Geburtstag, hrsg. v. Reimund Haas, Karl Josef Rivinius und Hermann-Josef Scheidgen, Köln, Weimar, Wien 2000, S. 39-55; Gotthard Klein: Berlin, Diözesanarchiv, in: Jochen Bepler/Hans Otte/Thomas Scharf-Wrede (Hrsg.): Schätze als Alltag. Dokumente aus kirchlichen Archiven und Bibliotheken, Regensburg 2001, S. 212.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

DW-TV Archive

Name:
DW-TV Archive

Kurzname:

Tr�gereinrichtung:

Strasse:
Voltastraße 6

Postleitzahl:
13355

Ort:
Berlin

Postanschrift:

Telefon:
(030) 46466100

Telefax:
(030) 46466199

E-Mail:
Gabriele.Voss@dw-world.de

Homepage:
www.dw-world.de

Leitung:
Gabriele Voß

Mitarbeiter(innen):
24 feste, 14 freie Mitarbeiter/innen

�ffnungszeiten:
täglich 5.30-1.00 (ausschließlich für interne Nutzer/innen)

Verkehrsverbindung:
Humboldthain (S1, 2, 25); Voltastraße (U8)

Best�nde:
Video-Archiv: Sendungen von DW-TV (ab 1992) und RIAS-TV (1988-1992), Agenturmaterial, Kamerakassetten; Bildarchiv: Bilder (digital und Papier-, Diavorlagen).

Findmittel:
Fernsehdatenbank FESAD, Signum-Bilddatenbank.

Ver�ffentlichungen:

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Evangelisches Zentralarchiv in Berlin (EZA)

Name:
Evangelisches Zentralarchiv in Berlin (EZA)

Kurzname:

Tr�gereinrichtung:
Evangelische Kirche in Deutschland (EKD) und Evangelische Kirche der Union (EKU)

Strasse:
Bethaniendamm 29

Postleitzahl:
10997

Ort:
Berlin

Postanschrift:

Telefon:
(030) 22504520

Telefax:
(030) 22504540

E-Mail:
archiv@ezab.de

Homepage:
www.ezab.de

Leitung:
Dr. Hartmut Sander

Mitarbeiter(innen):
18

�ffnungszeiten:
Mo-Do 9.00-16.00, Fr 9.00-14.00

Verkehrsverbindung:
Ostbahnhof (S3, 5, 7, 75, 9); Kottbuser Tor (U1, 12, 15, 8); Heinrichplatz (Bus 129); Bethaniendamm (Bus 140, 147, 265)

Best�nde:
a) Geschichte: Das Evangelische Zentralarchiv in Berlin wurde 1979 durch die Zusammenfassung des Archivs der EKD und des Archivs der EKU gebildet. Dem Archiv der EKD war 1972 das "Ökumenische Archiv" (Sammlung Prof. D. Friedrich Siegmund-Schultze), dem Archiv der EKU 1976 das "Archiv für die Geschichte des Kirchenkampfes" (Sammlung Prof. D. Dr. Günther Harder) eingegliedert worden. Als nach der Wiedervereinigung der Vertrag über das "Gemeinsame Archiv des Bundes der Evangelischen Kirchen in der DDR, der EKU - Bereich DDR - und der Evangelischen Kirche in Berlin-Brandenburg" am 30.6.1992 auslief, wurden die Bestände des Bundes und der EKU zum 1.7.1992 in das EZA überführt. Das Evangelische Zentralarchiv ist zuständig für das Schriftgut der Organe, Dienststellen und Einrichtungen der EKD und EKU und ihrer Rechts- und Funktionsvorgänger. Die Kirchenbuchstelle des Evangelischen Zentralarchivs ist die zentrale Nachweis- und Sammelstelle evangelischer Kirchenbücher aus den historischen deutschen Ostgebieten.
b) Art der Bestände: A) Kirchenbücher und andere Amtsbücher: ca. 7 200 Kirchenbücher ostdeutscher Kirchengemeinden der altpreußischen Landeskirche, 763 Militärkirchenbücher der preußischen Armee und der deutschen Wehrmacht, 75 Kirchenbücher und Namensregister aus Flüchtlingslagern in Dänemark, 48 Kirchenbücher aus Auslandsgemeinden, 489 Lager- und Protokollbücher ostdeutscher Kirchengemeinden der altpreußischen Landeskirche. - B) Akten (Auswahl aus den Beständen): 1. EKD und Vorgängereinrichtungen: Deutsche Ev. Kirchenkonferenz (Eisenacher Konferenz) 1851-1922 (Best. 1/A1), Deutscher Ev. Kirchenausschuss 1900-1933 (1944) (Best. 1/A2), Deutscher Ev. Kirchenbund 1922-1933 (Best. 1/A3), Deutsche Ev. Kirche 1933-1945 (Best. 1/A4), Kirchenbundesamt 1922-1933 (Best. 1/B), Deutsche Ev. Kirchenkanzlei 1933-1945 (Best. 1/C), Kirchenamt der EKD 1945-1986 (Best. 2), Kirchenamt der EKD - Berliner Stelle 1945-1991 (Best. 4), Kirchenkanzlei der EKD - Außenstelle Bonn 1946-1979 (Best. 99), Ratsvorsitzende der EKD 1952-1973 (Best. 81), Bevollmächtigter des Rates der EKD am Sitz der Bundesrepublik Deutschland 1945-1992 (Best. 87), Struktur- und Verfassungsausschuss der Synode der EKD 1970-1975 (Best. 86), Kirchliches Außenamt (mit Vorgängereinrichtungen) 1852-1986 (Best. 5 u. 6), Beauftragter des Rates der EKD für Umsiedler und Vertriebenenfragen 1954-1978 (Best. 54). - 2. Bund der Ev. Kirchen in der DDR und Vorgängereinrichtungen: Bevollmächtigter des Rates der EKD bei der Regierung der DDR 1949-1957 (Best. 103), Kirchenkanzlei der EKD für die Gliedkirchen in der DDR 1952-1969 (Best. 104), Geschäftsstelle der Konferenz der Ev. Kirchenleitungen in der DDR 1962-1979 (Best. 102), Sekretariat des Bundes der Ev. Kirchen in der DDR 1970-1991 (Best. 101). - 3. EKU und Vorgängereinrichtungen: Evangelischer Oberkirchenrat 1850-1963 (Best. 7), Generalsynode der Ev. Kirche der älteren preuß. Provinzen 1875-1933 (Best. 9), Verfassungsgebende Kirchenversammlung 1921-1922 (Best. 10), Kirchensenat 1925-1935 (Best. 11), Landeskirchenausschuss 1935-1937 (Best. 12), Kirchenleitung der ApU für die Westprovinzen 1945-1951 (Best. 13), Kirchenkanzlei der EKU - Bereich BRD und Berlin West 1964-1985 (Best. 8), Kirchenkanzlei der EKU (Ost) 1952-1967 (Best. 107), Kirchenkanzlei der EKU - Bereich DDR 1967-1991 (Best. 108). - 4. Sonstige kirchliche Zusammenschlüsse, Einrichtungen, Verbände, Organisationen und Vereine: Arnoldshainer Konferenz 1967-1986 (Best. 92), Arbeitsgemeinschaft Christlicher Kirchen in der DDR 1970-1998 (Best. 147), Deutscher Ev. Kirchentag 1949-1983 (Best. 71), Deutscher Ev. Kirchentag, Berliner Büro (DDR) 1950-1978 (Best. 95), Deutscher Ev. Kirchentag, Landesausschuss Berlin 1948-1986 (Best. 82), Archivamt der EKD 1946-1959 (Best. 15), Ev. Bibliothekarsschule in Göttingen 1947-1978 (Best. 16), Deutsches Ev. Institut für Altertumswissenschaft des Heiligen Landes 1900-1986 (Best. 55), Ev. Jerusalem-Stiftung 1857-1981 (Best. 56), Kirchlicher Hilfsausschuss für die Ostvertriebenen (Ostkirchenausschuss) 1945-1977 (Best. 17), Kirchendienst Ost 1945-1978 (Best. 18), Ev. Schrifttumsdienst 1951-1991 (Best. 64), Gräberfürsorge beim Bund der Ev. Kirchen in der DDR 1949-1992 (Best. 110), Predigerseminare der ApU/EKU 1899-1997 (Best. 19), Domkandidatenstift 1853-1936 (Best. 20), Stiftung mons pietatis 1696-1967 (Best. 21), Stift zum Heiligen Grabe 1811-1960 (Best. 22), Schleiermacherstiftung 1834-1976 (Best. 23), Ev. Kirchbautag 1949-1992 (Best. 28), Ausschuss für die Rückführung der Kirchenglocken e.V. 1947-1955 (Best. 52), Fakultätentag der ev.-theologischen Fakultäten in Deutschland 1956-1970 (Best. 40), Wissenschaftliche Gesellschaft für Theologie 1973-1995 (Best. 60), Arbeitsgemeinschaft der Archive und Bibliotheken in der ev. Kirche 1946-1989 (Best. 41), Arbeitsgemeinschaft ev. Erzieher in Deutschland 1955-1963 (Best. 42), Verein für religiöse Kunst in der ev. Kirche 1852-1943 (Best. 49), Ev. Studentengemeinde 1945-1998 (Best. 36), Ev. Studentengemeinden in der DDR 1946-1998 (Best. 141), Ev. Akademikerschaft in Deutschland 1954-1991 (Best. 37), Internationaler Versöhnungsbund 1938-1994 (Best. 31), Aktion Sühnezeichen/Friedensdienste 1958-1998 (Best. 97), Zentralstelle für Recht und Schutz der Kriegsdienstverweigerer aus Gewissensgründen 1959-1999 (Best. 72), Ev. Arbeitsgemeinschaft zur Betreuung der Kriegsdienstverweigerer 1957-1995 (Best. 73), Hendrik-Kraemer-Haus 1934-1992 (Best. 84), Konvent ev. Gemeinden aus Pommern (Hilfskomitee) e.V. 1945-1997 (Best. 46), Gemeinschaft ev. Schlesier (Hilfskomitee) 1945-1982 (Best. 47), Hilfskomitee für die ostbrandenburgischen Kirchengemeinden 1953-1974 (Best. 48), Gemeinschaft Evangelischer aus Danzig-Westpreußen (Hilfskomitee) 1937-1970 (Best. 59), Berliner Konvent ehemaliger ostpreußischer Pfarrer 1947-1985 (Best. 61), Hilfskomitee der ev. Deutschen aus Ostpreußen 1929-1986 (Best. 123), Ev. Gesellschaft für die protestantischen Deutschen in Amerika 1837-1930 (Best. 121), Ev. Arbeitsgemeinschaft für Kirchliche Zeitgeschichte 1959-1986 (Best. 124), Männerarbeit der EKD e.V. 1943-1991 (Best. 148), Ökumenischer Jugenddienst 1967-1993 (Best. 118), Kunstdienst Erfurt 1955-1997 (Best. 113), Soziale Geschäftsstelle für das ev. Deutschland 1886-1943 (Best. 44), Sydower Bruderschaft 1918-1998 (Best. 43), American Church in Berlin 1893-1969 (Best. 77). - C. Nachlässe (in Auswahl): Elisabeth Adler, Gerhard Bassarak, Ernst Viktor Benn, Hugo Boue, Ernst Brandenburg, Carl Brummack, Alfred Burgsmüller, Max Diestel, Walter Dress, Ernst Engelmann, Martin Fischer, Heinz Gefaeller, Dietrich Goldschmidt, Helmut Gollwitzer, Reinhard Groscurth, Gerhard Gülzow, Hermann Viktor Günther, Walter Hammer, Klaus Harms, Rudolf Hermann, Franz Reinhard Hildebrandt, Klara Hunsche, Aurel von Jüchen, Bernhard Karnatz, Heinrich Kloppenburg, Lothar Kreyssig, Hermann Kunst, Malte Kupas, Karl Kupisch, Olav Lingner, Familie Lisco, Ernst Loycke, Werner Marienfeld, Joachim Mehlhausen, Wilhelm Menn, Wilhelm Mensching, Eberhard Müller, Erich Müller-Gangloff, Gottfried Niemeier, Wilhelm Niesel, Walter Pabst, Hans Helmut Peters, Eitel-Friedrich von Rabenau, Werner Radatz, Hans Radtke, Hans-Jörg Ranke, Trutz Rendtorff, Julius Rieger, Joachim Rogge, Friedrich Ronneberger, Albrecht Schönherr, Ferdinand Schlingensiepen, August Wilhelm Schreiber, Arthur Schulze, Eberhard Schwarz, Wolfgang Schweitzer, Friedrich Siegmund-Schultze, Joachim Siegmund-Schultze, Oskar Söhngen, Carl Stange, Johannes Steffani, Hans Urner, Heinrich Vogel, Rudolf Weckerling, Friedrich Wieneke, Erwin Wilkens, Adolf Wischmann, Martin Ziegler, Wilhelm Zoellner. - D. Sammlungen (in Auswahl): Ökumenisches Archiv (Sammlung F. Siegmund-Schultze) (Best. 51), Archiv für die Geschichte des Kirchenkampfes (Sammlung G. Harder) (Best. 50), Sammlung historische Ostgebiete (Best. 506), Sammlung ostdeutscher Pfarrakten (Best. 507), Bildersammlung (Best. 500), Karten und Pläne (Best. 502), Vasa Sacra (Best. 503), Dokumentation "Ev. Kirche und Vertriebene" (Best. 512).
Bibliothek: ca. 69 000 Bde.

Findmittel:
Findbücher, Finddateien und Karteien.

Ver�ffentlichungen:
Ökumenische Schriftenreihe des Archivs der Evangelischen Kirche in Deutschland, Bd. 1-9, Soest 1962-1975; Veröffentlichungen des Evangelischen Zentralarchivs in Berlin, Bd. 1: Wolfgang Scheffler: Vasa sacra aus fünf Jahrhunderten. Geborgenes und erworbenes Kulturgut im Evangelischen Zentralarchiv in Berlin. Ein Katalog mit Aufnahmen von Heide Marie Moll u. a., 1984, Bd. 2: Friedrich Siegmund-Schultze 1885 1969. Begleitbuch zu einer Ausstellung des Evangelischen Zentralarchivs anlässlich seines 100. Geburtstages, bearb. von Christa Stache, 1985, Bd. 3: Verzeichnis der Kirchenbücher im Evangelischen Zentralarchiv in Berlin. Teil I: Die östlichen Kirchenprovinzen der Evangelischen Kirche der altpreußischen Union, bearb. von Christa Stache, 3. erweiterte u. verbesserte Auflage 1992, Bd. 4: Verzeichnis der Kirchenbücher im Evangelischen Zentralarchiv in Berlin. Teil II, Alt-Berlin, bearb. von Christa Stache. 1987, Bd. 5: Christa Stache: Das Evangelische Zentralarchiv in Berlin und seine Bestände, 1992, Bd. 6: Uwe Czubatynski: Armaria Ecclesiae. Studien zur Geschichte des kirchlichen Bibliothekswesens, Neustadt/Aisch 1998.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Fachhochschule für Technik und Wirtschaft Berlin. Hochschularchiv

Name:
Fachhochschule für Technik und Wirtschaft Berlin. Hochschularchiv

Kurzname:

Tr�gereinrichtung:

Strasse:
Treskowallee 8

Postleitzahl:
10313

Ort:
Berlin

Postanschrift:

Telefon:
(030) 50192377

Telefax:
(030) 50192325

E-Mail:
j.eckhardt@fhtw-berlin.de

Homepage:

Leitung:
Dr. Jochen Eckhardt

Mitarbeiter(innen):
1

�ffnungszeiten:
Mo, Mi 13.00-15.00, Di, Do 8.00-12.00 oder nach Vereinbarung

Verkehrsverbindung:
Karlshorst (S3); Tierpark (U5); Gregoroviusweg (Bus 296, 396); Treskowallee/Römerweg (Tram 26, 27, 28)

Best�nde:
Geschichte: Die 1991 gegründete Fachhochschule für Technik und Wirtschaft Berlin (FHTW) entstand aus der Ingenieurhochschule Berlin(-Lichtenberg), die 1988 aus der Ingenieurschule für Maschinenbau und Elektrotechnik Berlin hervorgegangen war und 1990 die Ingenieurschule für Bekleidungstechnik Berlin aufgenommen hatte. Das Berliner Hochschulgesetz ordnete 1991 die Verwaltungsvermögen der ehemaligen Hochschule für Ökonomie Berlin und der Ingenieurhochschule Berlin-Wartenberg der Fachhochschule zu. An der Hochschule für Ökonomie Berlin existierte ab 1958 ein Archiv, seit 1971 unter wissenschaftlicher Leitung. Es bildete den Rahmen für den Aufbau des Archivs der Fachhochschule, das Mitte der neunziger Jahre neue Räume mit modernen Regalanlagen bezog. Die unter desolaten Lagerungsbedingungen auf verschiedene Berliner Standorte verstreuten Bestände konnten hier konzentriert werden:
Fachhochschule für Technik und Wirtschaft Berlin (1991 ff.), Ingenieurhochschule Berlin (1988-1991), Ingenieurschule für Maschinenbau und Elektrotechnik Berlin (1949-1987), Ingenieurschule für Bekleidungstechnik Berlin (1874-1989), Hochschule für Ökonomie Berlin (1950-1991), Hochschule für Finanzwirtschaft Potsdam (1953-1956), Hochschule für Außenhandel Berlin-Staaken (1954-1958), Ingenieurhochschule Berlin-Wartenberg (1969-1991/92), Ingenieurschule für Landtechnik Berlin-Wartenberg (1952-1969).

Findmittel:
Die Bestände sind durch Repertorien, Karteien und elektronische Dateien erschlossen. Ferner existieren Bibliographien, Datensammlungen und Statistiken zu den Bildungseinrichtungen. Die personenbezogenen Unterlagen aller Bestände (Matrikel, Promotions- und Habilitationsakten, Personalakten u. ä.) wurden und werden elektronisch erfasst. Die Benutzung erfolgt entsprechend den Bestimmungen des Berliner Landesarchivgesetzes.

Ver�ffentlichungen:
FHTW Berlin. Festschrift 1999/FHTW Berlin 5 Jahre Kuratorialhochschule - 50 Jahre Ingenieurausbildung - 125 Jahre Textil- und Modeausbildung, Berlin 1999.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Feministisches Frauen Gesundheitszentrum e.V. (FFGZ)

Name:
Feministisches Frauen Gesundheitszentrum e.V. (FFGZ)

Kurzname:

Tr�gereinrichtung:

Strasse:
Bamberger Straße 51

Postleitzahl:
10777

Ort:
Berlin

Postanschrift:

Telefon:
(030) 2139597

Telefax:
(030) 2141927

E-Mail:
ffgzberlin@snafu.de

Homepage:
www.ffgz.de

Leitung:
Cornelia Burgert (für die Bibliothek)

Mitarbeiter(innen):

�ffnungszeiten:
Di, Do 10.00-13.00, Do 17.00-19.00

Verkehrsverbindung:
Spichernstraße (U1, 9); Viktoria-Luise-Platz (U4); Bayerischer Platz (U4, 7); Bus 204

Best�nde:
2 500 Fachbücher zum Themenkomplex Frauengesundheit: gynäkologische und nicht-gynäkologische Beschwerden, Krebs, speziell Brustkrebs, Krebsfrüherkennung, Gen- und Reproduktionstechnologien, Migrantinnen, Lesben; Frauengesundheitspolitik: Frauengesundheitsforschung, Gesundheitsvorsorge und Prävention; ganzheitliche Sichtweisen: alternative Heilmethoden, Bewegung, Ernährung; Körpergeschichte und weibliche Lebenshrythmen: Wechseljahre, Pubertät, Menstruation, Sexualität, Verhütung; 40 Zeitschriftenabonnements, Pressedokumentation.

Findmittel:

Ver�ffentlichungen:
CLIO - Die Zeitschrift für Frauengesundheit (erscheint 2x jährlich); Broschüren: Wechseljahre. Aufbruch in eine neue Lebensphase, 2003; Endometriose. Verstehen und verändern. Eine Broschüre zur Selbsthilfe, 2001; Die Schilddrüse - kleines Organ mit großer Wirkung, 2003.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Feuerwehrmuseum Berlin (Berliner Feuerwehr)

Name:
Feuerwehrmuseum Berlin (Berliner Feuerwehr)

Kurzname:

Tr�gereinrichtung:
Senat von Berlin / Berliner Feuerwehr

Strasse:
Berliner Straße 16

Postleitzahl:
13507

Ort:
Berlin

Postanschrift:

Telefon:
(030) 43906180, 38710933

Telefax:
(030) 43906182, 38710969

E-Mail:
museum@berliner-feuerwehr.de

Homepage:
www.berliner-feuerwehr.de

Leitung:
Stefan Sträubig

Mitarbeiter(innen):
3

�ffnungszeiten:
So-Di 9.00-12.00, Mi 16.00-19.00; Archiv: nach Vereinbarung

Verkehrsverbindung:
Tegel (S25); Alt-Tegel (U6); Schlieperstraße (Bus 133)

Best�nde:
Akten, Bücher, lose Blattsammlungen, Karteikarten, Fotos (von der Glasplatte bis zum digitalen Bild), Filme, Videos.

Findmittel:
Computer, Schlagwortkartei.

Ver�ffentlichungen:
Festschrift 150 Jahre Berliner Feuerwehr 1851-2001.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

FFBIZ Frauenforschungs-, -bildungs- und -informationszentrum e.V.

Name:
FFBIZ Frauenforschungs-, -bildungs- und -informationszentrum e.V.

Kurzname:

Tr�gereinrichtung:

Strasse:
Eldenaerstraße 35 III

Postleitzahl:
10247

Ort:
Berlin

Postanschrift:

Telefon:
(030) 95612678

Telefax:

E-Mail:
info@ffbiz.de

Homepage:
www.ffbiz.de

Leitung:
Prof. Dr. Ursula Nienhaus

Mitarbeiter(innen):
2

�ffnungszeiten:
Mo 13.00 bis 17.00 Uhr, Mi 16.00 - 20.00 Uhr, Do 13.00 - 17.00 Uhr

Verkehrsverbindung:
Ringbahn Storkower Str. + 5 Min. Fußweg. U-Bahn Samariter Str. + 5 Min. Fußweg. Lageplan unter www. ffbiz.de-Kontakt

Best�nde:
600 lfm oder etwa 1 200 000 Blatt frauenbezogene Informationseinheiten: Akten, Autographen, Nachlässe, Graue Materialien, Zeitungsausschnittdokumentationen, Fotos, Plakate, Sammlungsgut; Laufzeiten schwerpunktmäßig 1968 ff. (vgl. auch unsere Homepage unter: Angebote und Dienste: Sammlungen).

Findmittel:
Gedruckte Findbücher, Datenbanken, Zettelkataloge; Inventar Frauenbewegung in Deutschland 1968-1995 online abrufbar über unsere Homepage.

Ver�ffentlichungen:
Das FFBIZ, ein Frauenprojekt - eine alternative Institution. Die ersten zwanzig Jahre (1978-1998) (= Dokumentationen zur Neuen Frauengeschichte 5), Berlin 1998; Findbuch Frauen-Plakate 1969-1995, CD, Berlin 2001; über aktuelle Publikationen informieren wir regelmäßig auf unserer Homepage.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Filmmuseum Berlin - Deutsche Kinemathek

Name:
Filmmuseum Berlin - Deutsche Kinemathek

Kurzname:

Tr�gereinrichtung:
Bundesrepublik Deutschland

Strasse:
Potsdamer Straße 2

Postleitzahl:
10785

Ort:
Berlin

Postanschrift:

Telefon:
(030) 300 9030

Telefax:
(030) 300 90313

E-Mail:
info@filmmuseum-berlin.de

Homepage:
www.filmmuseum-berlin.de

Leitung:
Hans Helmut Prinzler

Mitarbeiter(innen):
54

�ffnungszeiten:
Di-Fr 10.00-13.00, 14.00-17.00 (Archive); Di, Mi, Fr 10.00-18.00, Do 10.00-20.00 (Bibliothek); Di, Mi, Fr, Sa, So 10.00-18.00, Do 10.00-20.00 (Museum)

Verkehrsverbindung:
Potsdamer Platz (S1, 2, 25, U2); Varian-Fry-Straße (Bus 148, 200, 248, 348)

Best�nde:
Archive: 12 000 deutsche und ausländische Stumm- und Tonfilme. Ein Schwerpunkt ist der Bestand zum Avantgarde-, Experimental- und Dokumentarfilm sowie zum Kino der Frühzeit. Die übrigen Sammlungen umfassen weit über eine Million Szenen-, Porträt- und Werkfotos, 30 000 Drehbücher, 20 000 Plakate, 60 000 Filmprogramme, Zulassungskarten, Noten, filmografische und biografische Materialien, Nachlässe. Kostüme, Skizzen, Dekorationsentwürfe und Modelle belegen Entwicklungen der Filmarchitektur in Deutschland von 1919 bis in die Gegenwart. Ein wichtiger Schwerpunkt der Sammlungen sind die Dokumente zum deutschen Filmexil. In der Marlene Dietrich Collection Berlin wird der 1993 vom Land Berlin erworbene umfangreiche Nachlass der Künstlerin bewahrt. Ein Spezialbereich ist die Sammlung zum Thema Special Effects/Phantastischer Film. Die filmtechnische Sammlung umfasst historische Kinomaschinen (Kameras, Projektoren, Zubehörgeräte, Mutoskope usw.) von der Frühzeit des Kinos bis heute.
Bibliothek: Sammlung von Printmedien zu Film und Fernsehen. Der Freihandbestand - zwischen 60 000 und 70 000 Medieneinheiten - umfasst Publikationen zur Filmgeschichte incl. Vor- und Frühgeschichte des Films und Geschichte der Fotografie, Monografien zu Personen, Themen und Institutionen, Veröffentlichungen zur Filmtheorie, Filmkritik, Filmästhetik, zu einzelnen Filmen, Filmgenres, zur Filmtechnik und Filmindustrie, Drehbücher, die im Buchhandel erhältlich sind, und eine große Sammlung filmspezifischer Nachschlagewerke. Besondere Sammelschwerpunkte sind Filmexil/Exilfilm und Publikationen zum Drehbuchschreiben sowie Biografien. Außer Monografien und "Grauer Literatur" besitzt die Bibliothek etwa 220 laufende Zeitschriftentitel und über 7 000 Zeitschriftentitel insgesamt. Die besonders wertvolle Sammlung historischer Filmzeitschriften steht zum Teil auch als Mikfrofilm zur Verfügung. Ferner findet man Material zu nationalen und internationalen Filmfestivals, Verleih- und Ausstellungskataloge sowie Filmtheater-Programme. Ein umfangreiches Pressearchiv - zwanzig deutsche und ausländische Zeitungen werden regelmäßig ausgewertet - ermöglicht unter anderem eine Recherche über Personen, Filmtitel, Institutionen und Festivals.

Findmittel:
Karteien.

Ver�ffentlichungen:
Wolfgang Jacobsen (Hrsg.): Babelsberg. Das Filmstudio, 3. aktualisierte Neuausgabe, Berlin 1992; Wolfgang Jacobsen, Hans Helmut Prinzler (Hrsg.): Käutner, Berlin 1992; Helga Belach, Wolfgang Jacobsen (Hrsg.): Cinemascope. Zur Geschichte der Breitwandfilme, Berlin 1993; Gero Gandert (Hrsg.): Der Film der Weimarer Republik. 1929, Berlin 1993; Wolfgang Jacobsen, Helga Belach, Norbert Grob (Hrsg.): Erich von Stroheim, Berlin 1994; Wolfgang Jacobsen, Hans Helmut Prinzler, Werner Sudendorf (Hrsg.): Kino - Movie - Cinema, Berlin 1995; Werner Sudendorf, Hans-Peter Reichmann (Red.), Kunst- und Ausstellungshalle der Bundesrepublik Deutschland/Stiftung Deutsche Kinemathek: Marlene Dietrich, Bonn 1995; Wolfgang Jacobsen, Helga Belach, Norbert Grob (Hrsg.): William Wyler, Berlin 1996; Wolfgang Jacobsen (Hrsg.): G. W. Pabst, Berlin 1997; Wolfgang Jacobsen, Hans Helmut Prinzler (Hrsg.): Siodmak Bros., Berlin 1998; Norbert Grob, Rolf Aurich, Wolfgang Jacobsen (Hrsg.): Otto Preminger, Berlin 1999; Rolf Aurich, Wolfgang Jacobsen, Gabriele Jatho (Hrsg.): Künstliche Menschen. Manische Maschinen. Kontrollierte Körper, Berlin 2000; Wolfgang Jacobsen, Hans Helmut Prinzler, Werner Sudendorf (Hrsg.): Filmmuseum Berlin. Katalog, Berlin 2000; Rolf Aurich, Wolfgang Jacobsen, Cornelius Schnauber (Hrsg.): FL. Fritz Lang, Berlin 2001; Rolf Aurich, Wolfgang Jacobsen (Hrsg.): European 60s. Revolte, Phantasie & Utopie, Berlin 2002; Kristina Jaspers, Nicole Rother (Hrsg): Flügelschlag / A Beat of the Wings. Engel im Film / Angels in Film, Berlin 2003; Filmmuseum Berlin - Deutsche Kinemathek (Hrsg.): Die ideale Frau. Ruth Leuwerik und das Kino der fünfziger Jahre, Berlin 2004; Hans Helmut Prinzler / Gabriele Jatho (Hrsg): New Hollywood 1967-1976. Trouble in Wonderland, Berlin 2004. Außerdem gibt das Filmmuseum Berlin die Periodika "FilmExil" und "FilmGeschichte/SDK-Newsletter" heraus.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Filmmuseum Potsdam

Name:
Filmmuseum Potsdam

Kurzname:

Tr�gereinrichtung:
Land Brandenburg; Ministerium für Wissenschaft, Forschung und Kultur

Strasse:
Breite Str. 1A

Postleitzahl:
14467

Ort:
Potsdam

Postanschrift:

Telefon:
(0331) 271810

Telefax:
(0331) 2718126

E-Mail:
info@filmmuseum-potsdam.de

Homepage:
www.filmmuseum-potsdam.de

Leitung:
Dr. Bärbel Dalichow

Mitarbeiter(innen):
33

�ffnungszeiten:
Mo-So 10.00-18.00

Verkehrsverbindung:
Potsdam-Stadt (S7); Alter Markt (Tram 90, 92)

Best�nde:
Sammlungen: Die Sammlungstätigkeit des Filmmuseums Potsdam konzentriert sich - im Einklang mit der Hauptaufgabenstellung des Museums - auf die Film- und Kinogeschichte Deutschlands, besonders auf die Entwicklung des Babelsberger Filmstudios von 1912 bis in die Gegenwart, auf seine Künstler und Filme sowie auf die Geschichte der Filmtechnik in Deutschland. Dabei richtet das Museum sein Augenmerk auf die Entwicklung des Mediums und seine Protagonisten in den Diktaturen sowie auf den Anteil von Frauen an der Filmproduktion. Zu den Beständen gehören Schenkungen, Nachlässe, Übereignungen noch vor dem Tode, also sogenannte Vorlässe. Die Übersicht nennt über 80 Namen, die mit größeren Objekten vertreten sind, etwa von Hans Albers, Lilian Harvey, Zarah Leander, Henny Porten, Camilla Spira und vielen namenhaften DEFA-Schauspielern und -Regisseuren wie Lutz Dammbeck, Rolf Kirsten, Frank Beyer, Kameramännern, Filmarchitekten und Kostümbildnern.
600 000 Positive und 140 000 Negative umfasst die Fotosammlung, in denen sich Babelsberger Frühgeschichte der Stummfilmzeit über die Ufa-Jahre bis zur DEFA-Epoche spiegelt. Das Schriftgut umfasst 2 000 Drehbücher, Treatments, aber auch Szenarien wie etwa zu Bakys "Münchhausen" (1941) und Riefenstahls "Tiefland" (1940/54). Man kann 12 000 Plakate einsehen, die ein nahezu lückenloses Bild der DEFA-Produktionen und der in der DDR gezeigten ausländischen Produktionen vermittelt. Im Presseausschnittarchiv findet man 90 000 Ausschnitte aus Zeitungen und Zeitschriften der DDR und der Bundesrepublik. Zu den Schätzen der Kinotechnik gehören 3 000 Geräte. Schmuckstück der Sammlung ist und bleibt der als Dauerleihgabe des Bundesarchivs - Filmarchivs im Museum ausgestellte Doppelprojektor "Bioskop", mit dem Max Skladanowsky am 1. November 1895 im Berliner Wintergarten seine ersten Filme vorführte. Auskunft über die umfangreichen Bestände gibt ein Katalog und die Website des Potsdamer Filmmuseums.

Findmittel:
Bestands-Katalog.

Ver�ffentlichungen:
Filmmuseum Potsdam Imagebroschüre. Informationsbroschüre des Filmmuseums Potsdam und zur Geschichte der Babelsberger Ufa- und DEFA-Filmstudios sowie Texte zur Entwicklung der Filmtechnik, Hrsg.: Filmmuseum Potsdam, 2002; Kinematographische Apparate aus 100 Jahren. Bildband zur technischen Sammlung im Filmmuseum Potsdam, Hrsg.: Filmmuseum Potsdam, Berlin 2001; DEFA-Dokumentarfilme 1946-92, Hrsg.: Filmmuseum Potsdam, Berlin 1996/2000; Blaue Augen, blauer Fleck. Kino im Wandel von der Diva zum Girlie, Hrsg.: Filmmuseum Potsdam, Berlin 1997; Das zweite Leben der Filmstadt Babelsberg. DEFA-Spielfilme 1946-1992, Hrsg.: Filmmuseum Potsdam, Berlin 1994; Der Marstall. Das älteste Bauwerk von Potsdam, Hrsg.: Filmmuseum Potsdam, 1966; Hans Albers - Ein Leben in Bildern, Hrsg.: Filmmuseum Potsdam, Berlin 1997; Peter Warnecke: "Laube Liebe Hoffnung. Kleingartengeschichte". Buch zur gleichnamigen Ausstellung des Filmmuseums 2001, Hrsg.: Filmmuseum Potsdam, Berlin 2001; Liebe mit Achtzig. Asta Nielsen - Christian Theede: Briefe, Hrsg.: Allan O. Hagedorff und Filmmuseum Potsdam, Berlin 1997; Renate Epperlein: MAUS OLEUM. 25 Jahre Sendung mit der Maus, Hrsg.: Westdeutscher Rundfunk Köln und Filmmuseum Potsdam, 1996; Oskar Messter - Filmpionier der Kaiserzeit (KINtop Schriften 2), Hrsg.: Martin Loiperdinger, Deutsches Museum München, Basel/Frankfurt am Main 1994; Regie: Frank Beyer, Hrsg.: Filmmuseum Potsdam, Berlin 1995; Vor der Kamera. Fünfzig Schauspieler in Babelsberg, Hrsg.: Filmmuseum Potsdam, Berlin 1995.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Franz-Neumann-Archiv e.V. Berlin

Name:
Franz-Neumann-Archiv e.V. Berlin

Kurzname:

Tr�gereinrichtung:

Strasse:
Ackerstraße 76

Postleitzahl:
13355

Ort:
Berlin

Postanschrift:

Telefon:
(030) 4635007

Telefax:
(030) 4635007

E-Mail:
FranzNeumannArchiv@t-online.de

Homepage:
www.franz-neumann-archiv.de

Leitung:
Dr. Manfred Rexin, Dr. Sieglinde Heppener

Mitarbeiter(innen):
2

�ffnungszeiten:
Di 10.00-15.00

Verkehrsverbindung:
Nordbahnhof (S2); Voltastraße (U9); Reinickendorfer Straße (U6); Bus 120, 245

Best�nde:
Nachlässe führender sozialdemokratischer Politikerinnen und Politiker Berlins, Fotosammlung.

Findmittel:
z. T. computergestützte Bestandslisten.

Ver�ffentlichungen:
1848-1948. Stimmen zur Märzrevolution im Berlin der Nachkriegszeit; 64 % für die SPD. Erinnerungen an eine Wahl vor 50 Jahren; Bettina Michalski: Louise Schroeders Schwestern, 1996; Manfred Rexin/Siegfried Heimann: Paul Löbe. Ein politisches Leben in Tondokumenten, Hrsg: ABI August-Bebel-Institut/FNA Franz-Neumann-Archiv-Berlin e.V; Die Menschen mitnehmen! Zum 10. Todestag von Jürgen Egert. Herausgegeben von Barbara Stolterfoht und Michael Elze, Berlin 2002; Partei ergreifen für die Jugend. Eine Berliner Senatorin im Aufbruch der 70er Jahre. Erinnerungen zum 10. Todestag von Ilse Reichel. Herausgegeben von Ingrid Stahmer und Enrico Troebst, Berlin 2003; Sieglinde und Siegfried Heppener, Quellen zu Opposition und Widerstand Ostberliner Sozialdemokraten 1945-1961. Eine Handreichung.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Französische Kirche zu Berlin. Archiv

Name:
Französische Kirche zu Berlin. Archiv

Kurzname:

Tr�gereinrichtung:

Strasse:
Gendarmenmarkt

Postleitzahl:
10117

Ort:
Berlin

Postanschrift:

Telefon:
(030 ) 2291760

Telefax:
(030) 2041505

E-Mail:

Homepage:

Leitung:
Robert Violet

Mitarbeiter(innen):
1

�ffnungszeiten:
nach Vereinbarung

Verkehrsverbindung:
Hausvogteiplatz (U2); Stadtmitte (U2, 6); Französische Straße (U6); Unter den Linden (Bus 100)

Best�nde:
Akten des Consistoriums der Französischen Kirche; soziale Einrichtungen; Kirchenbau; gleichzeitig - Depositalarchiv: fr. ref. Kirchengemeinden: Angermünde, Battin, Bergholz, Bernau, Französisch Buchholz, Cottbus, Gramzow, Groß-Ziethen, Potsdam, Prenzlau, Schwedt, Spandau, Strasburg und Moderamenarchiv.

Findmittel:
Im Aufbau.

Ver�ffentlichungen:

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Freie Universität Berlin. FB Erziehungswissenschaft und Psychologie. Archiv zur Berliner Schulgeschichte

Name:
Freie Universität Berlin. FB Erziehungswissenschaft und Psychologie. Archiv zur Berliner Schulgeschichte

Kurzname:

Tr�gereinrichtung:

Strasse:
Habelschwerdter Allee 45

Postleitzahl:
14195

Ort:
Berlin

Postanschrift:

Telefon:
(030) 83855967

Telefax:
(030) 83855441

E-Mail:
gruene@zedat.FU-Berlin.de

Homepage:
www.fu-berlin.de

Leitung:
Dr. Michael-Sören Schuppan

Mitarbeiter(innen):
2

�ffnungszeiten:
nach Vereinbarung

Verkehrsverbindung:
Lichterfelde West (S1); Thielplatz (U1); Bus X11, X83, 101, 111, 148

Best�nde:
Kopien und Duplikate von Akten nach 1945, Nachlässe Berliner Pädagogen aus dem 20. Jahrhundert.

Findmittel:
Provisorische Findlisten bzw. -bücher.

Ver�ffentlichungen:
G. Wedel: Berliner Schulalmanach (= Materialien und Studien zur Geschichte der Berliner Schule), Baltmannsweiler 1993.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Freie Universität Berlin. Institut für Publizistik- und Kommunikationswissenschaft. Bibliothek für Publizistik

Name:
Freie Universität Berlin. Institut für Publizistik- und Kommunikationswissenschaft. Bibliothek für Publizistik

Kurzname:

Tr�gereinrichtung:

Strasse:
Malteserstraße 74-100

Postleitzahl:
12249

Ort:
Berlin

Postanschrift:

Telefon:
(030) 83858432/83853237

Telefax:
(030) 83858436

E-Mail:
birgit.rehse@fu-berlin.de

Homepage:
www.kommwiss.fu-berlin.de/institut/bibpub/

Leitung:
Dr. Birgit Rehse

Mitarbeiter(innen):
6

�ffnungszeiten:
im Semester Mo-Do 9.00-19.00, Fr 9.00-17.00; in den Semesterferien Mo, Mi, Do 10.00-17.00, Di 10.00-19.00, Fr 10.00-15.00

Verkehrsverbindung:
Bus X83, 183, 283

Best�nde:
Gesamtzahl der Bände: 112 755, davon ca. 75 000 Bände Monographien. Sammelgebiete: Massenkommunikation, Öffentliche Meinung, Empirische Kommunikationsforschung, Kommunikationstheorie, Presse, Elektronische Medien, Journalismus, Medienrecht, Werbung, Public Relations, Rhetorik, Informationswissenschaft, Dokumentationswissenschaft, Kommunikationsgeschichte, Rundfunk.
Laufend gehaltene Zeitschriften 227: Fachzeitschriften, Zeitungen, Zeitschriften, Illustrierte, Magazine etc.; Mikromaterial: 7163.

Findmittel:
OPAC der FU, Zettelkataloge (Altbestand): Alphabetischer, Systematischer und Standortkatalog.

Ver�ffentlichungen:

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Freie Universität Berlin. Institut für Theaterwissenschaft. Theaterhistorische Sammlung Walter Unruh

Name:
Freie Universität Berlin. Institut für Theaterwissenschaft. Theaterhistorische Sammlung Walter Unruh

Kurzname:

Tr�gereinrichtung:

Strasse:
Grunewaldstraße 35

Postleitzahl:
12165

Ort:
Berlin

Postanschrift:

Telefon:
(030) 83850347

Telefax:
(030) 83850360

E-Mail:
walach@zedat.fu-berlin.de

Homepage:
ubu.theater.fu-berlin.de/sammlungen

Leitung:
Dr. Dagmar Walach

Mitarbeiter(innen):
2

�ffnungszeiten:
Mo, Mi, Do 10.00-17.00, Fr 10.00-15.00

Verkehrsverbindung:
Schmidt-Ott-Straße (Bus X83, 183); Botanischer Garten (Bus 101)

Best�nde:
Bibliothek, ca. 20 000 Bände, darunter eine umfangreiche Stückesammlung sowie eingerichtete Rollen- und Regiebücher, ca. 315 Bände aus dem 18. Jh., vor allem Periodika, und ca. 4 000 Bände aus dem 19. Jh., ca. 20 000 Theaterzettel, vorwiegend von Berliner Bühnen, 8 000 Theaterprogramme, ca. 6 000 Autographen, 30 Nachlässe bzw. Teilnachlässe oder Sammlungen, Rollen- und Zivilporträts von Bühnenkünstlern, Szenenfotos; Bilddokumente (Theatergebäude, Stichesammlung, Kostümbildentwürfe, Trachtenbilder, Bühnenbildentwürfe).

Findmittel:
Alte Kataloge z. T. vorhanden, neue Findmittel werden erstellt (Printkatalog, CD-Rom).

Ver�ffentlichungen:

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Freie Universität Berlin. Universitätsarchiv

Name:
Freie Universität Berlin. Universitätsarchiv

Kurzname:

Tr�gereinrichtung:
Freie Universität Berlin

Strasse:
Boltzmannstraße 20; s. auch zwei weitere Standorte

Postleitzahl:
14195

Ort:
Berlin

Postanschrift:

Telefon:
(030) 83853237

Telefax:
(030) 83853499

E-Mail:
archiv@fu-berlin.de

Homepage:
www.fu-berlin.de/uniarchiv

Leitung:
Dr. Birgit Rehse (Leiterin), Frank Lehmann (stellvertr. Leiter)

Mitarbeiter(innen):
6 feste und 2 zeitlich befristete Mitarbeiter/innen, 1 Auszubildende/r

�ffnungszeiten:
Mo–Fr 9.00–15.00Uhr und nach Vereinbarung. Um Voranmeldung wird gebeten

Verkehrsverbindung:
U 3 Thielplatz; Bus M 11, M 48

Best�nde:
Das Universitätsarchiv sichert und bewahrt das archivwürdige Schriftgut der 1948 gegründeten Freien Universität Berlin sowie der ihr nahestehenden Körperschaften und erschließt es mit dem Ziel, dieser Überlieferung der Forschung und der interessierten Öffentlichkeit zugänglich zu machen. Darüber hinaus verfügt das Universitätsarchiv seit 2004 über das APO-Archiv, eine Sammlung zur Geschichte der 68er-Bewegung mit Unterlagen von politischen Studentengruppen und Gruppierungen der außerparlamentarischen Opposition. Der Umfang der Archivbestände insgesamt beträgt zurzeit rund 6.300 lfm verteilt auf drei Standorte in Dahlem, Reinickendorf und Lankwitz. Den Benutzern steht außerdem eine Handbibliothek mit rund 2.500 Bänden als Präsenzbestand zur Verfügung.

Bestände und Unterlagen aus folgenden Provenienzen sind im Universitätsarchiv zu finden:

Abteilung 1 / Bestände aus FU-Provenienz:

1.1 Zentrale Organe: Kuratorium, Konzil, Rektorat (1948-1969) bzw. Präsidium (Präsident, Vizepräsidenten, Kanzler) ab der hochschulinternen Strukturreform von 1970 ff., Akademischer Senat, Ständige Kommissionen beim AS (z. B. Kommission für Entwicklungsplanung, Lehre und Studium, Forschung und wissenschaftlichen Nachwuchs, Bibliothekswesen).

1.2 Kuratorialverwaltung (1948-1969) bzw. Zentrale Universitätsverwaltung (ab 1970): Unterlagen zu Personal-, Haushalts-, Rechts-, Zulassungs-, und Außenangelegenheiten sowie Angelegenheiten von Lehre, Studium und Forschung (Personalakten der FU-Mitarbeiter/innen, Disziplinarverfahren, Gerichtsverfahren, Verträge, Kooperationen und Partnerschaften, Grundstücks-/Gebäudeverwaltung, Immatrikulation in- und ausländischer Studierender (Matrikelbücher, Studentenakten, Studentenkartei 1948-1996) etc.

1.3 Fakultäten (1948-1969) bzw. Fachbereiche (nach 1970 ff.), Zentralinstitute und Zentraleinrichtungen: Unterlagen der Fakultäts-, bzw. Fachbereichs- und Institutsverwaltungen (Protokolle der Fakultäts- bzw. Fachbereichsratssitzungen, Berufungsverfahren, Geschäftsakten einzelner Institutsdirektorien etc.), vereinzelt auch Geschäftsakten von Lehrstühlen und Diensthandakten der Hochschullehrer (Forschungsprojekte und -kontakte, Korrespondenz, Lehre, Gutachten, Manuskripte etc.).

1.4 Akademische Abschlüsse: Habilitations- und Promotionsakten und -schriften; Magister-, Diplom-, Master-, Bachelorprüfungsakten; teilw. auch Abschlussarbeiten.

Abteilung 2 / Bestände aus Teil-Provenienz FU:

2.1 Studentica: Allgemeiner Studentenausschuss (AStA), Protokolle des Konvents, Slg. politischer Hochschulgruppen, sonstige Studentica (s. a. Abt. 5/APO-Archiv).

2.2 Der FU nahestehende Körperschaften und Vereine: Deutsche Hochschule für Politik, Ernst-Reuter-Gesellschaft, Notgemeinschaft für eine freie Universität, Bund freier Wissenschaft, Pädagogische Hochschule, Kaiserin-Auguste-Victoria-Haus etc.

Abteilung 3 / Nachlässe:

Vor- und Nachlässe von FU-Angehörigen und FU-nahestehenden Wissenschaftlern/innen, darunter Hans Leisegang, Walter Krauland, Alexander Dinghas etc.

Abteilung 4 / Sammlungen:

Amtsblatt der FU Berlin; sonstige FU-Publikationen (Namens- und Vorlesungsverzeichnisse, FU-Rundschreiben, FU-Info, FU-Nachrichten, Presseschau, Jahresberichte, Statistiken, Forschungsberichte etc.); Zeitungsausschnittssammlung zu Persönlichkeiten in der Wissenschaft; Zeitungsausschnittssammlung zur Universitätsgeschichte FU Berlin und zur Hochschulpolitik; Plakatsammlung; Flugblattsammlung; Fotosammlung; Slg. audiovisueller Medien; Slg. musealer Objekte (Talare, Gastgeschenke, Gemälde, Zeichnungen, Skulpturen etc.).

Abteilung 5 / APO-Archiv:

FU-Studentica (AStA, Konvent, Flugschriften etc.); Sachthematische APO-Sammlung; Slg. und Aktenbestand Sozialistischer Deutscher Studentenbund (SDS) (inkl. Bundesvorstand); Slg. politischer Studentenverbände mit Schwerpunkt West-Berlin (SHB, LSD, GSG, ESG, RCDS, VDS etc.); Slg. und Aktenbestand Kommunistischer Bund Westdeutschlands (KBW); Slg. sonstiger ML-Gruppierungen sowie trotzkistischen Organisationen; Slg. Aktionsgemeinschaft von Demokraten und Sozialisten Westberlin (ADS); Slg. Anarchisten und Situationisten; Gerichtsverhandlungen zu den Fällen Kurras, Mahler, Kommune I (Mitschriften); Fotosammlung; Plakatsammlung; Slg. Devotionalien; Slg. Periodika; Handbibliothek.

Findmittel:
Findmittel zu einzelnen Beständen, Datenbank im Aufbau

Ver�ffentlichungen:
Thomas P. Becker (Hrsg.): Die Studentenproteste der 60er Jahre. Archivführer – Chronik – Bibliographie, Köln u. a.: Böhlau, 2000; Michael Engel: Der Nachlaß des Philosophen und Physikers Hans Leisegang im Universitätsarchiv der Freien Universität Berlin, in: Naturwissenschaften und Archive: naturwissenschaftliche und technische Überlieferung in Archiven wissenschaftlicher Einrichtungen, Frühjahrstagung der Fachgruppe 8 des Verbands deutscher Archivarinnen und Archivare am 27. März 2001 in Rostock, Rostock: Univ., 2001, S. 87-92; Michael Engel: Das Universitätsarchiv der Freien Universität Berlin, in: Fünfzig Jahre Universitätsbibliothek der Freien Universität Berlin, hrsg. v. Ulrich Naumann und Doris Fouquet-Plümacher, Berlin: UB, 2002, S. 521-534.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Geheimes Staatsarchiv Preußischer Kulturbesitz

Name:
Geheimes Staatsarchiv Preußischer Kulturbesitz

Kurzname:

Tr�gereinrichtung:

Strasse:
Archivstraße 12-14

Postleitzahl:
14195

Ort:
Berlin

Postanschrift:

Telefon:
(030) 8390100

Telefax:
(030) 83901180

E-Mail:
gsta.pk@gsta.spk-berlin.de

Homepage:
www.gsta.spk-berlin.de

Leitung:
Dr. Jürgen Kloosterhuis

Mitarbeiter(innen):
97

�ffnungszeiten:
Mo, Mi-Fr 8.00-15.30, Di 8.00-19.30

Verkehrsverbindung:
Podbielskiallee oder Dahlem-Dorf (U1); Bus X11, 110, 183

Best�nde:
Das Geheime Staatsarchiv ist vornehmlich für die Überlieferung der zentralen Behörden und Institutionen des ehemaligen brandenburg-preußischen Staates und für bestimmte Provinzialüberlieferungen zuständig. Es übernimmt zudem das bei der Hauptverwaltung der Stiftung Preußischer Kulturbesitz erwachsende Schriftgut und andere nichtstaatliche Provenienzen. Die Überlieferungsgruppen in Auswahl: - Zentralbehörden der Mark Brandenburg ab 1188: VII. HA Urkunden (1188-1858); I. HA, Rep. 78 und 78 A Kurmärkische Lehnskanzlei (1242-1571); I. HA, Rep. 97 Kammergericht (1652-1929) - Zentrale Verwaltungs- und Justizbehörden Brandenburg-Preußens bis 1808: I. HA Geheimer Rat (1603 gegründet), Rep. 1-69 (1411-1825); I. HA, Rep. 96 und 96 A Geheimes Zivilkabinett, ältere Periode (1688-1808); II. HA Generaldirektorium (1722 gegründet) (1460-1838) - Sonderverwaltungen der Übergangszeit 1806-1815: V. HA Königreich Westphalen (1806-1815) - Staatsoberhaupt und Oberste Staatsbehörden, Ministerien und andere Zentralbehörden Preußens ab 1808: I. HA, Rep. 89 Geheimes Zivilkabinett, jüngere Periode (1807-1920); I. HA, Rep. 74 Staatskanzleramt (1808-1824); I. HA, Rep. 90 und 90 A Staatsministerium (1714-1945); III. HA Ministerium der auswärtigen Angelegenheiten (1806-1936); I. HA, Rep. 75 A Preußische Gesandtschaft am Bundestag (1816-1875); I. HA, Rep. 77 Ministerium des Innern (1807-1934); I. HA, Rep. 151 Finanzministerium (1808-1945); I. HA, Rep. 76 Kultusministerium (1807-1935); I. HA, Rep. 120 Ministerium für Handel und Gewerbe (1808-1935); I. HA, Rep. 93 Ministerium der öffentlichen Arbeiten (1807-1921); I. HA, Rep. 87 Ministerium für Landwirtschaft, Domänen und Forsten (1787-1934); I. HA, Rep. 84 a Justizministerium (1807-1934); I. HA, Rep. 169 C Abgeordnetenhaus (1849-1918); I. HA, Rep. 169 D Landtag (1919-1933) - Stiftung Preußischer Kulturbesitz ab 1957: I. HA, Rep. 600 Präsident und Hauptverwaltung - Haus und Hof der Hohenzollern: Brandenburg-Preußisches Hausarchiv (BPH), Urkunden (1272-1938); BPH, Rep. 25-71 (Personal-Reposituren zu den Mitgliedern des Hauses Hohenzollern) (1248-1980); BPH, Rep. 113 Oberhofmarschallamt (1720-1936); I. HA Geheimer Rat, Rep. 36 Hof- und Güterverwaltung (1468-1870); I. HA, Rep. 100 Ministerium des Königlichen Hauses (1808-1945) - Preußische Armee: IV. HA Preußische Armee (bis 1866/67, überwiegend Reste des ehemaligen preußischen Heeresarchivs in Potsdam); VIII. HA, Militärkirchenbücher (1662-1944) - Territorialüberlieferungen, Provinzial- und Lokalbehörden: X. HA Brandenburg (1340-1989); XVIII. HA Provinz Sachsen (1552-1970); XV. HA Pommern (1286-1945); XVII. HA Schlesien (1230-1997); XX. HA Historisches Staatsarchiv Königsberg: XX. HA, Urkunden (1198-ca. 1800); XX. HA, Ordensbriefarchiv (1198-1525); XX. HA, Ordensfolianten (1245-1525); XX. HA, Herzogliches Briefarchiv (1525-1700); XX. HA, Ostpreußische Folianten (1455-1917); XX. HA, Etats-Ministerium (1525-1804); XX. HA, Rep. 1 ff. (Behörden der Provinz Ostpreußen) (18.-20. Jh.); XIV. HA Westpreußen (1253-1945); XVI. HA Posen (1654-1933); XIX. HA Grenzmark Posen-Westpreußen (1806-1944) - Nichtstaatliche Provenienzen: VI. HA Familienarchive und Nachlässe (ca. 650) (v. a. Nachlässe ziviler Staatsbeamter, wissenschaftlicher Beamter, Militärs, sowie Bedienter des Hauses und Hofes der Hohenzollern) (16.-20. Jh.); Schriftgut der Freimaurerlogen und freimaurerähnlichen Vereinigungen (1731-1941) - (Vor-) Archivische Sammlungen: XII. HA (Amts-)Drucksachen: XII. HA, I Zeitungen und Zeitschriften (1713-2000); XII. HA, IV Flugblätter und Plakate (1705-2000); XII. HA, VI Edikte und Verordnungen (1664-1848); XI. HA Karten, Plankammern Potsdam (1651-1850), Frankfurt/Oder (1670-1870), Marienwerder (1670-1919), Bromberg (1772-1912); XX. HA Historisches Staatsarchiv Königsberg, Plankammern Königsberg (1592-1894) und Gumbinnen (18.-19. Jh.); XI. HA Karten, Festungspläne Kriegsministerium (1763-1914); XI. HA Karten, Allgemeine Kartensammlung (1550-1999); VIII. HA Siegel, Wappen, Genealogie (13.-20. Jh.); IX. HA Bilder (v. a. Porträts historisch bedeutender Persönlichkeiten, Städteansichten, historische Ereignisse, technische Zeichnungen) (1590-2000); XIII. HA Schutzfilme, Digitalisate. Gesamtumfang 35 000 lfm.

Findmittel:
(Sammel-)Findbücher, Findkarteien, Inventare; Findmittel-Nachweise zu den einzelnen Beständen bei Jürgen Kloosterhuis: Die Tektonik des Geheimen Staatsarchivs Preußischer Kulturbesitz, in: Archivarbeit für Preußen. Symposion der Preußischen Historischen Kommission und des Geheimen Staatsarchivs Preußischer Kulturbesitz aus Anlass der 400. Wiederkehr der Begründung seiner archivishen Tradition, hrsg. von Jürgen Kloosterhuis, Berlin 2000 (Veröffentlichungen aus den Archiven Preußischer Kulturbesitz. Arbeitsberichte Nr. 2), S. 71-257 (s. auch in der Homepage); Verzeichnis der Inventare, ebenda, S. 475 f.

Ver�ffentlichungen:
Veröffentlichungen aus den Archiven Preußischer Kulturbesitz, Bd. 1 ff., Köln, Berlin 1967 ff., zuletzt Bd. 56: Karl Freiherr von Müffling: Offizier - Kartograph - Politiker (1775-1851): Lebenserinnerungen und kleinere Schriften, bearb. und erg. von Hans-Joachim Behr, Köln, Weimar, Wien 2003; Veröffentlichungen aus den Archiven Preußischer Kulturbesitz. Beihefte, Bd. 1 ff., Köln, Weimar, Wien 1991 ff., zuletzt Bd. 9: Erika Schachinger: Die Dorotheenstadt 1673-1708: eine Berliner Vorstadt, Köln, Weimar, Wien 2001; Veröffentlichungen aus den Archiven Preußischer Kulturbesitz. Arbeitsberichte Nr. 1 f., Berlin 1996 ff., zuletzt Nr. 3: Der Bestand Ministerium für Handel und Gewerbe, Abteilung Berg-, Hütten- und Salinenverwaltung im Geheimen Staatsarchiv Preußischer Kulturbesitz, bearb. von Frank Althoff und Susanne Brockfeld, Berlin 2003.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

GrauZone - Archiv der ostdeutschen Frauenbewegung

Name:
GrauZone - Archiv der ostdeutschen Frauenbewegung

Kurzname:

Tr�gereinrichtung:

Strasse:
(c/o Robert-Havemann-Gesellschaft), Schliemannstraße 23

Postleitzahl:
10437

Ort:
Berlin

Postanschrift:

Telefon:
(030) 44710816, 44341613

Telefax:
(030) 44341613

E-Mail:
archiv-grauzone@web.de

Homepage:
www.archiv-grauzone.de

Leitung:
Samirah Kenawi

Mitarbeiter(innen):

�ffnungszeiten:
nur nach Vereinbarung

Verkehrsverbindung:
Schönhauser Allee (S41, 42, 8, U2); Fröbelstraße (Tram 1); Stargarder Straße (Tram 13); Husemannstraße (Tram 20)

Best�nde:
Sammlung zu Frauengruppen in der DDR der 80er Jahre, Sammlung zum Unabhängigen Frauenverband (UFV). Gesammelt werden Akten aus privaten Nachlässen, Fotos, Plakate, Videos, Periodika, Buttons u. a.

Findmittel:
FAUST-Datenbank, Bestandsverzeichnis.

Ver�ffentlichungen:
Samirah Kenawi: Frauengruppen in der DDR der 80er Jahre. Eine Dokumentation, Berlin 1995; Archiv GrauZone. Bestandsverzeichnis der Sammlung zur ostdeutschen Frauenbewegung, hrsg. von Samirah Kenawi, Berlin 2002.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Heimatmuseum Charlottenburg-Wilmersdorf. Archiv

Name:
Heimatmuseum Charlottenburg-Wilmersdorf. Archiv

Kurzname:

Tr�gereinrichtung:
Bezirksamt Charlottenburg-Wilmersdorf von Berlin

Strasse:
Schlossstraße 69

Postleitzahl:
14059

Ort:
Berlin

Postanschrift:

Telefon:
(030) 902913200

Telefax:
(030) 902913202

E-Mail:
heimatmuseum@charlottenburg-wilmersdorf.de

Homepage:
www.charlottenburg-wilmersdorf.de (Homepage des Heimatmuseums)

Leitung:
Sonja Miltenberger

Mitarbeiter(innen):
1

�ffnungszeiten:
nach Vereinbarung; günstiger Zeitraum für Anrufe: Mi+Do 10.00-16.00, Fr 10.00-12.00

Verkehrsverbindung:
Westend (S); Richard-Wagner-Platz (U7); Sophie-Charlotte-Platz (U12, 2); Bus X21, 109, 145, 210

Best�nde:
Die Bestände ergeben sich aus den jeweiligen Forschungs-, Publikations- und Ausstellungsprojekten des Museums zur Lokal- und Alltagsgeschichte des Bezirks von den Anfängen bis zur Gegenwart.
Das Charlottenburger Archiv umfasst folgende Sammlungsbereiche: Bildarchiv mit ca. 30 000 Fotos (70% Reprografien, 30% Originale), ca. 500 Fotos aus dem de Laforgue-Nachlass, ca. 3 000 Postkarten, ca. 2 000 Dias aus dem de Laforgue-Nachlass und etwa 50 Gemälde, 680 Karten/Pläne incl. Bauzeichnungen etc., ca. 900 Dokumenten-Nachweise incl. Teilnachlässe und Konvolute, Sammlung von ca. 40 000 Zeitschriften-Ausschnitten, vor allem seit den 1980er Jahren, ca. 2 200 Objekte zur Alltagsgeschichte, Bibliothek mit ca. 6 000 Bänden incl. Graue Literatur.

Findmittel:
Nur intern (Zettelkatalog, Bestandslisten, EDV-Dokumentation LIDOS 4.1.).

Ver�ffentlichungen:
Deutsche Weihnacht. Ein Familienalbum 1900-1945, Berlin 1997; Birgit Jochens: Charlottenburg in historischen Postkarten, Berlin 1997; Sonja Miltenberger: Charlottenburg in historischen Karten und Plänen, Berlin 1998; Stuttgarter Platz, Berlin 1999; Zwischen Rebellion und Reform. Frauen im Berliner Westen, Berlin 1999; Von Tonwaren zum Olympiastadion. Die Berliner Familie March, Berlin 2000; Trümmerbahn und Trümmerfrauen, Berlin 1999; Bleib übrig. Eine Dokumentation, Berlin 1999; Schmargendorf, Berlin 2000; Fritsch, Irene: Leben am Lietzensee, Berlin 2001; Leben in der Paul-Hertz-Siedlung, Berlin 2002.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Heimatmuseum Köpenick. Archiv

Name:
Heimatmuseum Köpenick. Archiv

Kurzname:

Tr�gereinrichtung:
Bezirksamt Treptow-Köpenick von Berlin

Strasse:
Alter Markt 1

Postleitzahl:
12555

Ort:
Berlin

Postanschrift:

Telefon:
(030) 61723351

Telefax:
(030) 61723352

E-Mail:
info@heimatmuseum-koepenick.de

Homepage:
www.heimatmuseum-koepenick.de

Leitung:
Claus-Dieter Sprink, Krystyna Schade

Mitarbeiter(innen):
3

�ffnungszeiten:
Do 10.00-12.00, 13.00-18.00

Verkehrsverbindung:
Köpenick (S3); Tram 62, 68

Best�nde:
Die Bestände des Heimatmuseums gliedern sich in die Bereiche Bibliothek, Presse-, Karten- und Fotoarchiv sowie die Urkundensammlung. Die Bibliothek umfasst ca. 6 000 Bände zur Regional- und Landesgeschichte, darunter Ausgaben regionalhistorischer Zeitschriften (Die Mark, Brandenburgia) sowie komplette Jahrgänge von Betriebszeitungen der ehemaligen DDR-Großbetriebe. Die Kartensammlung beinhaltet ca. 2 500 Karten Berlin-Brandenburg mit Schwerpunkt Stadt und Bezirk Köpenick. Das Pressearchiv wird als Zeitungsausschnittsammlung durchschnittlich seit 1950 geführt und ist in Sachgruppen geordnet. Die Fotosammlung umfasst ca. 10 000 Gebrauchsfotos und zahlreiche alte Fotografien sowie Glasplattennegative zur Stadt-, Bezirks- und Industriegeschichte Köpenicks. Darüber hinaus existieren in der Fotosammlung ca. 2 300 Ansichtskarten zur Stadt- und Bezirksgeschichte. Ein Schwerpunkt der Urkundensammlung bildet der Bestand "Köpenicker Fischerkietz", zu dem unter anderem sämtliche landesherrliche Fischereiprivilegien aus dem 15. bis 18. Jahrhundert gehören. Sonderbestände stellen die "Hauptmann-von-Köpenick"-Sammlung sowie das 1990 von der ehemaligen SED-Kreisleitung Köpenick übernommene "Geschichtsarchiv" dar.

Findmittel:
Verzeichnisse und Findbücher, Karteien, Bibliothek allegroC.

Ver�ffentlichungen:
Claus-Dieter Sprink: Köpenick von den Anfängen bis zur Gegenwart. Katalog zur Dauerausstellung im Heimatmuseum Köpenick, Heimatmuseum Köpenick 2001; ders.: Köpenicker Sagen, Heimatmuseum Köpenick 1999; ders.: Unterordnen?! Jewiss! Aber unter wat drunter?! Katalog zur "Hauptmann von Köpenick"-Ausstellung im Rathaus Köpenick, Heimatmuseum Köpenick 1999; ders.: Köpenicker Blutwoche Juni 1933 - Dokumentation. Katalog zur Dauerausstellung in der Gedenkstätte Köpenicker Blutwoche, Heimatmuseum Köpenick 1996.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Heimatmuseum Reinickendorf

Name:
Heimatmuseum Reinickendorf

Kurzname:

Tr�gereinrichtung:
Bezirksamt Reinickendorf von Berlin

Strasse:
Eichborndamm 215-239

Postleitzahl:
13437

Ort:
Berlin

Postanschrift:
Heimatmuseum Reinickendorf, Alt-Hermsdorf 35, 13467 Berlin

Telefon:
(030) 4044062, 40009270

Telefax:
(030) 40009273

E-Mail:
noch nicht vorhanden

Homepage:

Leitung:
Dr. Cornelia Gerner

Mitarbeiter(innen):
2, Pförtnerin und Archivkraft (halbe Stelle)

�ffnungszeiten:
Mi, Do 9.00-15.00, Fr 9.00-12.00

Verkehrsverbindung:
Hermsdorf (S1); Almutstraße (Bus 225)

Best�nde:
6 000 Fotos, 1 300 Postkarten, Präsenzbibliothek für den Bezirk Reinickendorf mit ca. 950, für Berlin mit ca. 1 100 und für Brandenburg mit ca. 430 Büchern und Broschüren, Zeitungsarchiv für Reinickendorf im Aufbau.

Findmittel:
Ordner und Listen.

Ver�ffentlichungen:
Wahlich, Ulrike: Reinickendorf 1945/46. Die erste Nachkriegszeit. Unter Mitwirkung von Klaus Göbel und Ingolf Wernicke, Hrsg.: Bezirksamt Reinickendorf von Berlin, Heimatmuseum Reinickendorf, Berlin 1995 (Beiträge zur Geschichte Reinickendorfs; 1); Wahlich, Ulrike: Die Franzosen in Berlin. Besatzungsmacht-Schutzmacht-Partner für Europa, Hrsg.: Bezirksamt Reinickendorf von Berlin, Jaron, 1. Auflage Berlin 1996; Das letzte Berliner Dorf : 750 Jahre Lübars, Hrsg.: Bezirksamt Reinickendorf von Berlin, Jaron, 2. Auflage 1997; Wahlich, Ulrike: Die Borsig Werke in Tegel. Berlin-Reinickendorf als Industriestandort. Unter Mitarbeit von Edda Riese, Hrsg.: Bezirksamt Reinickendorf von Berlin, Jaron, 1. Auflage 1998; Lese-Zeiten. Ein Jahrhundert Bibliothekswesen in Reinickendorf, Hrsg.: Bezirksamt Reinickendorf von Berlin, Jaron, 1. Auflage 1999; Die Dorfkirchen in Berlin Reinickendorf Alt-Wittenau, Hrsg.: Arbeitskreis Dorfkirche Alt-Wittenau, Berlin 2001; Friedhöfe in Berlin Reinickendorf, Heft 1, Hrsg.: Bezirksamt Reinickendorf von Berlin, Berlin 2002.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Heimatmuseum Zehlendorf. Museum und Archiv

Name:
Heimatmuseum Zehlendorf. Museum und Archiv

Kurzname:

Tr�gereinrichtung:
Heimatverein Zehlendorf e.V. (1886)

Strasse:
Clayallee 355

Postleitzahl:
14169

Ort:
Berlin

Postanschrift:

Telefon:
(030) 8022441

Telefax:
(030) 80903291

E-Mail:
Heimatverein.Zehlendorf@t-online.de

Homepage:
www.heimatmuseum.zehlendorf.de

Leitung:
Joachim Scharnowski, Angela Grützmann, Benno Carus

Mitarbeiter(innen):

�ffnungszeiten:
Museum: Mo, Do 16.00-19.00; Archiv: nach Vereinbarung

Verkehrsverbindung:
Zehlendorf (S1); Zehlendorf Eiche (Bus X10, 110, 115, 118, 148, 211, 623)

Best�nde:
Personen- und ortsbezogene Archivalien zur Dorf- und Bezirksgeschichte; Foto- und Postkartensammlung zu Zehlendorf; Zehlendorfer Künstler/Zehlendorf in künstlerischer Darstellung; Zeitungsarchiv (Zehlendorfer Anzeiger, Teltower Kreisblatt, bezirkliche Publikationen); Bibliographien, Periodika mit Schwerpunkt Zehlendorf.

Findmittel:
Findbuch, computerunterstützte Recherche, Fotozuordnung z. T. auf Kartengrundlage.

Ver�ffentlichungen:
Heimatbrief Zehlendorf; Zehlendorfer Chronik; Zehlendorfer Jahrbuch.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

HEROLD. Verein für Heraldik, Genealogie und verwandte Wissenschaften

Name:
HEROLD. Verein für Heraldik, Genealogie und verwandte Wissenschaften

Kurzname:

Tr�gereinrichtung:

Strasse:
Archivstraße 12-14

Postleitzahl:
14195

Ort:
Berlin

Postanschrift:

Telefon:
(030) 83901100 (nur zu den Öffnungszeiten)

Telefax:

E-Mail:

Homepage:

Leitung:
Werner Heegewaldt

Mitarbeiter(innen):
1

�ffnungszeiten:
Di 16.00-19.00

Verkehrsverbindung:
Dahlem-Dorf oder Podbielskiallee (U1); Bus X11, 110, 183

Best�nde:
Die Archivbestände sind aus den umfangreichen Sammlungen des 1869 gegründeten Vereins hervorgegangen, der die älteste Institution seiner Art im deutschsprachigen Raum darstellt. Die Sammlungstätigkeit erstreckt sich auf alle Historischen Hilfswissenschaften, insbesondere Genealogie, Heraldik und Sphragistik. 1985 erfolgte eine organisatorische Trennung zwischen Vereinsbibliothek und -archiv. Die Bestände aus der Zeit vor 1945 sind zum Teil durch Verlagerung und Kriegseinwirkung in Verlust geraten. Die Ordnungs- und Verzeichnungsarbeiten sind noch nicht abgeschlossen.
Akten: Zum Vereinsarchiv im eigentlichen Sinne gehören die aus der Geschäfts- und Publikationstätigkeit des Herold erwachsenen Akten, die von 1869 bis 1945 nur sehr lückenhaft überliefert sind. Ergänzt werden sie durch die Vereinsmatrikel mit biographischen Angaben, Bildnissen und Korrespondenzen von ca. 5 000 Mitgliedern des Herold, die in einer Datenbank erfasst sind. Außerdem verwahrt das Archiv die Akten der Deutschen Wappenrolle, in der seit 1922 deutsche Familienwappen registriert und in einer eigenen Buchreihe publiziert werden.
Sammlungen (in Auswahl): Allgemeine Genealogische Sammlung (nach Familiennamen geordnetes Material, das von Einzelnotizen bis zu Ausarbeitungen reicht); Genealogien deutscher und europäischer Adelsfamilien (Sammlungen Bardeleben, La Roche, Lindner, Maltitz u. a.), pommerscher Familien (Sammlungen Lassahn-Spruth, Schmude und Zitzewitz ), preußischer Beamter und Offiziere des 19. Jhs. (Sammlung Serlo), mecklenburgischer Juristenfamilien (Sammlung Weden) und von Scharfrichtern (Sammlung Treichel); Stammbücher (u. a. von Friedrich Warnecke); Siegelsammlungen; Wappenbilderkartei des Herold (ca. 150 000 Nachweise), Wappenbilderverzeichnisse von Dielitz und Grotefend; Wappenhandschriften (Wappenbuch von den Ersten, Caspar Sturm, Codex Saurma, Hochzeitsbuch der Rehlinger u. a.); Urkunden (u. a. Lehn- u. Wappenbriefe des 14.-20. Jhs.); Korb'sches Bildarchiv; Sammlung Klietmann (Institut für wissenschaftliche Ordenskunde).
Nachlässe (in Auswahl:): Georg Conrad, Stephan Kekule von Stradonitz, Johannes Schulz-Blochwitz, Familienarchiv Stechow, Gero von Wilcke.

Findmittel:
Findbücher und Karteien.

Ver�ffentlichungen:
Der Herold. Vierteljahrsschrift für Heraldik, Genealogie und verwandte Wissenschaften. NF, Bd. 16, 45. Jg., 2002; Herold-Jahrbuch. Neue Folge, Bd. 6, Neustadt a. d. Aisch 2001; Festschrift zum 125jährigen Bestehen des Herold zu Berlin 1869-1994, hrsg. von Bernhart Jähnig und Knut Schulz, Berlin 1994; Wappenfibel. Handbuch der Heraldik, bearb. von Ludwig Biewer, Neustadt a. d. Aisch 1998; Vom Nutzen und Frommen der Historischen Hilfswissenschaften. Beiträge der gemeinsamen Tagung des Herold mit seiner Fachgruppe Historische Hilfswissenschaften am 5.10.1999, hrsg. von Friedrich Beck und Eckart Henning, Neustadt a. d. Aisch 2000; Verzeichnis der Nachlässe und genealogischen Sammlungen des Herold, in: Genealogisches Jahrbuch, Bd. 36, Neustadt a. d. Aisch 1996; Jürgen Arndt: Die Entstehung und Entwicklung der Deutschen Wappenrolle, in: Generalregister zur Deutschen Wappenrolle, Neustadt a. d. Aisch 1975; Johann Karl von Schroeder: Die Sammlung La Roche des Vereins Herold, in: Der Herold, Bd. 9, 23. Jg., 1980; ders.: Die genealogische Sammlung Lindner, in: Mitteilungen des Herold 2, 1973; ders.: Die genealogische Sammlung Maltitz, in: Der Herold, Bd. 8, 20. Jg., 1977; ders.: Die Sammlung Serlo, in: Der Herold, Bd. 11, 29. Jg., 1986; Kurt-Gerhard Klietmann: Das Institut für wissenschaftliche Ordenskunde, in: Genealogie, Bd. XII, 23, 1974; Werner Heegewaldt: Das Korb'sche Bildarchiv im Verein Herold, in: Der Herold, Bd. 12, 31. Jg., 1988; Kurt Zahn: Findbuch zum Nachlass von Gero von Wilcke im Archiv des Herold, Teil 1 Stammreihen (= Schriftenreihe der Arbeitsgemeinschaft für mitteldeutsche Familienforschung e.V., Nr. 100, März 2001).

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Hexlibris im EWA-Frauenzentrum e.V.

Name:
Hexlibris im EWA-Frauenzentrum e.V.

Kurzname:

Tr�gereinrichtung:

Strasse:
Prenzlauer Allee 6

Postleitzahl:
10405

Ort:
Berlin

Postanschrift:

Telefon:
(030) 4425542, 4428023

Telefax:
(030) 40301476

E-Mail:
ewa.ev@arcormail.de

Homepage:
www.ewa-frauenzentrum.de

Leitung:
Brigitte May, Maria Schabbel

Mitarbeiter(innen):
1

�ffnungszeiten:
Di 16.00-19.00; Do 15.00-18.00 und nach Vereinbarung

Verkehrsverbindung:
Alexanderplatz (S, U2, 5, 8); Senefelderplatz (U2); Bus 100, 157, 348; Tram 1

Best�nde:
EWA-Akten, -Veranstaltungsplakate und -Fotos, Zeitschriften, Zeitungsausschnitte, POP-Akten, BfN-Akten, Graue Materialien.

Findmittel:
FAUST-Datenbank (im Aufbau).

Ver�ffentlichungen:

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Historisches Archiv des Ostdeutschen Sparkassen- und Giroverbandes (OSGV)

Name:
Historisches Archiv des Ostdeutschen Sparkassen- und Giroverbandes (OSGV)

Kurzname:

Tr�gereinrichtung:

Strasse:
Leipziger Straße 51

Postleitzahl:
10117

Ort:
Berlin

Postanschrift:

Telefon:
(030) 20691231

Telefax:
(030) 20692231

E-Mail:
britta.weschke@osgv.de

Homepage:
www.osgv.de

Leitung:
Britta Weschke, M.A.

Mitarbeiter(innen):
1 (und 4 Studenten)

�ffnungszeiten:
Mo-Fr nach Vereinbarung

Verkehrsverbindung:
Spittelmarkt (U2); Bus 147

Best�nde:
Diverse Archivalien zum Sächsischen Sparkassenverband, zum Mitteldeutschen Sparkassenverband, zur Sparkassenarbeit in der DDR, Materialien zur Wendezeit 1989-91, Festschriften, Chroniken, Bilanzen und Jahresberichte zu diversen Sparkassen des ostdeutschen Raumes, Gesetzblätter sowie zahlreiche (historische) Monographien älteren Jahrgangs u. a. m. Umfang: ca. 100 lfm, 45 Umzugskisten zum Archiv des Sächsischen Sparkassen- und Giroverbandes, über 100 Umzugskisten zum Verbandsarchiv des OSGV (inkl. DDR-Zeit), umfangreiche Objekt-, Foto- und Plakatsammlung zum Thema Sparkassengeschichte.

Findmittel:
Abgabeverzeichnisse, Lotus-Notes-Datenbank (Eigenentwicklung).

Ver�ffentlichungen:
Britta Weschke: Informations- und Wissensmanagement im Ostdeutschen Sparkassen- und Giroverband, in: Wissenschaft für die Praxis 9/2002, S. 20 f.; Britta Weschke: Ärmelschoner oder elektronische Datenverarbeitung?!, in: Die Sparkassenzeitung 31.8.2001, S. 15; Taler, Taler, du sollst wandern ... Ausstellung zum Thema Geld, in: Die Sparkassenzeitung 28.11.2003, S. 7; Money - Money - Money ... Erste Wanderausstellung des Ostdeutschen Sparkassen- und Giroverbandes, in: Wissenschaft für die Praxis 26.5.2004, S. 23.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Historisches Archiv zum Tourismus (HAT)

Name:
Historisches Archiv zum Tourismus (HAT)

Kurzname:

Tr�gereinrichtung:
Freie Universität Berlin. Willy-Scharnow-Institut für Tourismus

Strasse:
Malteserstraße 74-100 L

Postleitzahl:
12449

Ort:
Berlin

Postanschrift:

Telefon:
(030) 83870140 (Sekretariat)

Telefax:

E-Mail:
info@fu-tourismus.de oder spode@fu-tourismus.de

Homepage:
home.worldonline.de/home/hasso.spode

Leitung:
Dr. Hasso Spode, Dr. Kristiane Klemm

Mitarbeiter(innen):
2

�ffnungszeiten:
nach Vereinbarung

Verkehrsverbindung:
Bus 183

Best�nde:
Reiseführer und -berichte, Wissenschaft ab dem 18. Jh., Statistiken, Zeitschriften, Prospekte u. a. Werbemittel, Plakate sowie Fotoalben, Akten, Tonträger, Karten zum Themenkreis Reisen, Tourismus und Region. Schwerpunkt zeitlich: 20. Jh. Den Grundstock bilden die Sammlungen Schwarzenstein (DTZ), Burger (DRV) und Kahn (Kahn-Scharnow-Reisen) sowie fremdenverkehrswissenschaftliche Materialien des Instituts für Tourismus.

Findmittel:
Aufstellung der gedruckten Materialien nach der Pertinenz (sprechende Signaturen: Sachgebiet oder Region). Die Monographien sind größtenteils mit EDV (LITTY v3) erfasst (> 8 000 Titel), ebenso die Plakate (> 1000 Stücke); die Periodika (ca. 150 Titel) sind komplett erfasst, Karten nur teilweise (ca. 1 500 Stücke erfasst). Die EDV-Recherche ist nur vor Ort möglich. Die Aktenbestände (vor allem Slg. Schwarzenstein) sind weitgegehend unerschlossen und nur begrenzt zugänglich.

Ver�ffentlichungen:

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Hochschule für Film und Fernsehen "Konrad Wolf". Archiv

Name:
Hochschule für Film und Fernsehen "Konrad Wolf". Archiv

Kurzname:

Tr�gereinrichtung:

Strasse:
Marlene-Dietrich-Allee 11

Postleitzahl:
14482

Ort:
Potsdam

Postanschrift:

Telefon:
(0331) 6202431

Telefax:
(0331) 6202439

E-Mail:
c.erkens@hff-potsdam.de

Homepage:
www.bibl.hff-potsdam.de

Leitung:
Corinna Erkens

Mitarbeiter(innen):
2

�ffnungszeiten:
Mo-Fr 9.00-16.00

Verkehrsverbindung:
Griebnitzsee (RB 21); August-Bebel-Straße (Bus 696)

Best�nde:
Archivierung der HFF-Produktionen seit 1956. Insgesamt ca. 3 200 Titel, darunter Dokumentarfilme, Spielfilme, Animationsfilme. Sofern keine VHS-Kopie vorhanden ist, können die Filme am Schneidetisch gesichtet werden. Außer der Pflege und Kontrolle der Bestände übernimmt das Archiv auch die Bereitstellung der HFF-Produktionen für Festivals im In- und Ausland sowie für kleine Kinobetreiber, die HFF-Filme gerne ins Programm nehmen.

Findmittel:
Online-Zugang über HFF-Hompage, OPAC.

Ver�ffentlichungen:

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Humboldt Universität zu Berlin. Institut für Europäische Ethnologie. Archiv für Alternativkultur - Sammlung Josef Wintjes

Name:
Humboldt Universität zu Berlin. Institut für Europäische Ethnologie. Archiv für Alternativkultur - Sammlung Josef Wintjes

Kurzname:

Tr�gereinrichtung:

Strasse:
Schiffbauerdamm 19

Postleitzahl:
10117

Ort:
Berlin

Postanschrift:

Telefon:
(030) 20933719

Telefax:
(030) 20933726

E-Mail:
eva.kuby@rz.hu-berlin.de

Homepage:
www2.hu-berlin.de/ethno/seiten/index.htm

Leitung:
Eva Kuby, M.A.

Mitarbeiter(innen):

�ffnungszeiten:
Di 10.00-12.00, 13.00-16.00, Do 10.00-13.00 und nach Vereinbarung

Verkehrsverbindung:
Friedrichstraße (S, U6)

Best�nde:
Das Archiv wurde im November 1995 dem Institut für Europäische Ethnologie der Humboldt-Universität zu Berlin als Nachlass des "Literarischen Informationszentrums Josef Wintjes" zu Forschungszwecken gestiftet. Das 1969 von Josef Wintjes (1947-1995) gegründete Informations- und Vertriebszentrum in Bottrop diente dem Vertrieb von Alternativpresse und verstand sich als Diskussionsforum für unterschiedlichste literarische und politische Gruppierungen. Wintjes und sein Informationszentrum verkörperten gleichzeitig auch die wichtigste Quelle der literarischen Alternativszene. Es ist ein einzigartiges Beispiel kulturgeschichtlicher Dokumentation der Struktur und Geschichte einer Bewegung. Die Sammlung literarischer, künstlerischer und politischer Archivmaterialien der "Neuen sozialen Bewegungen" in Deutschland seit den 1960er Jahren umfasst Zeitungen, Zeitschriften, "Graue" Literatur, Flugschriften sowie Dokumente wie Raubdrucke, Reader, Plakate und grafische Darstellungen zur Alternativ- und Underground-Presse, zu alternativen Verlagen und Buchläden bzw. zur Protestbewegung überhaupt. Auch Teile der Privatsammlung von Henryk M. Broder, Bestände von Benno Käsmayrs MaroVerlag Augsburg oder Sammlungen einzelner "Social Beat"-Autoren sowie Fotos, Video- und Tonkassetten gehören zum Fundus.
Sammlungsschwerpunkte sind heute: Neue soziale Bewegungen, Friedensbewegung, Anti-Atombewegung, Dritte Welt, Anarchismus, Frauenbewegung, alternative Lebensformen, Kommunen, Stadt- und Regionalmagazine, Studenten-, Lehrlings- und Schülerzeitschriften, Science Fiction und Fantasy Fanzines, Comic- und Musikzeitschriften, Punk Fanzines, Literatur, Kunst und Kultur, Esoterik, Spiritualität, ganzheitliches Leben, Social-Beat-Zeitschriften, Plakate und Flyer. Gleichzeitig verfügt das Archiv über eine Sammlung von Fotos, Video- und Tonkassetten.

Findmittel:
Findbuch, Filemaker Datenbank mit ca. 1 700 Datensätzen, Briefwechsel, Bücher.

Ver�ffentlichungen:
Berliner Blätter. Ethnographische und Ethnologische Beiträge, Nr. 15, Thema: Subkultur - Popkultur - Underground. Oktober 1997, 10 Beiträge: Rolf Lindner: Subkultur. Stichworte zur Wirkungsgeschichte eines Konzepts, S. 5-12; Helmut Hartwig: Kompost und Kritik - Zur Ästhetik der Alternativszene, S. 13-20; Thomas Kramer: Asterix und die Freak Brothers, Comic-Unterwelten als Teile alternativer Kultur, S. 21-27; Jonathan Friedman: Die Sapeurs in Brazzaville - Zur politischen Ökonomie der Eleganz, S. 28-38; Jay Rutledge: "Danse des Griffes" - 50 Jahre Musik und Mode am Kongo, S. 39-46; Dick Hebdige: Die Moods in Soho - Zur Bedeutung eines subkulturellen Phänomens, S. 47-52; Kazuhiro Ochi: Die wunderbare Welt der weiblichen Pornographie in Japan. Eine Vergleichsstudie zur weiblichen Sexualität in Ost und West, S. 53-63; Benno Käsmayr: Der Maro Verlag - Ein Drahtseil-Akt des Machbaren, S. 64-68; Jürgen Kipp: Die "Zwerge Gutenbergs" - Retrospektive der Mainzer Minipressen-Messe, S. 69-72; Victoria Schwenzer: Bibliographie zur Subkultur, S. 73-84.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Humboldt-Universität zu Berlin. Institut für Europäische Ethnologie. Archiv der Landesstelle für Berlin-Brandenburgische Volkskunde

Name:
Humboldt-Universität zu Berlin. Institut für Europäische Ethnologie. Archiv der Landesstelle für Berlin-Brandenburgische Volkskunde

Kurzname:

Tr�gereinrichtung:
Landesstelle

Strasse:
Schiffbauerdamm 19

Postleitzahl:
10117

Ort:
Berlin

Postanschrift:

Telefon:
(030) 20933721, 20933720

Telefax:
(030) 20933726

E-Mail:
Monika.Wolf.1@rz.hu-berlin.de

Homepage:
www2.hu-berlin.de/ethno/seiten/index.htm

Leitung:
Monika Wolf

Mitarbeiter(innen):

�ffnungszeiten:
nach Vereinbarung

Verkehrsverbindung:
Friedrichstraße (S, U6)

Best�nde:
Es umfasst Teilbestände von den 20er bis in die 80er Jahre des 20. Jahrhunderts. Den Grundstock bilden Hinterlassenschaften des ehemaligen Instituts für Volkskunde (später Wissenschaftsbereich Kulturgeschichte/Volkskunde) an der Akademie der Wissenschaften der DDR und partiell auch des Instituts an der Humboldt-Universität Berlin. Langjährige Forschungsprojekte, Fragebogenaktionen und historische Untersuchungen namhafter Wissenschaftler und Forschungsgruppen finden hier in vielfältigen Vorarbeiten, Konzeptionen und Überarbeitungen zu Publikationen, Korrespondenzen, Literaturrecherchen etc. ihren Niederschlag. So ist u. a. der Sprachforscher und Volkskundler Wolfgang Steinitz mit Unterlagen, Sammlungen und Varianten zu seinen "Deutschen Volksliedern demokratischen Charakters aus sechs Jahrhunderten" vertreten. Umfängliche Archivalien entstammen den Erhebungen/Fragebogenaktionen der Arbeitsgruppe "Bäuerliche Arbeit und Wirtschaft" in den 1960/70er Jahren, aus deren Recherchen auch ein einzigartiges Bildarchiv hervorgegangen ist (Wolfgang Jacobeit u. a.). Weiterhin liegen Teilbestände aus der Erfassungsaktion "Alte Bauten im neuen Dorf" (1962-1968/70) und aus dem langjährigen regionalen volkskundlichen Forschungsvorhaben zur "Magdeburger Börde" (Mitte 1960er-1970er Jahre) vor. Zum Fundus gehören gleichfalls eine Reihe älterer volkskundlicher Sammlungen und Hinterlassenschaften aus der Vorkriegszeit. Mitte 2001 hinzugekommen ist der Teilnachlass von Richard Beitl (1900-1982) aus seinen Berliner Forschungszeiten, darunter interessante Untersuchungen zur Region Berlin-Brandenburg aus den 1930er Jahren. Sammelschwerpunkte bilden heute Hinterlassenschaften volkskundlich/kulturwissenschaftlicher Forschungen, die mit dem Standort Berlin/Brandenburg verbunden sind.

Findmittel:
Word-Datei, annotiertes Findbuch.

Ver�ffentlichungen:
M. Wolf: Projekte, Fragebögen, Fotos, Wissenschaftler. Neue Fragen an alte Materialien - Anmerkungen zum Archiv der Landesstelle für Berlin-Brandenburgische Volkskunde, S. 63-72. In: Berliner Blätter. Ethnographische und ethnologische Beiträge. Heft 31, 2003, Lit-Verlag.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Humboldt-Universität zu Berlin. Universitätsarchiv

Name:
Humboldt-Universität zu Berlin. Universitätsarchiv

Kurzname:

Tr�gereinrichtung:

Strasse:
Eichborndamm 113

Postleitzahl:
13403

Ort:
Berlin

Postanschrift:

Telefon:
(030) 39048319

Telefax:
(030) 39048310

E-Mail:
winfried.Schultze@archiv@hub-zub

Homepage:

Leitung:
Dr. Winfried Schultze

Mitarbeiter(innen):
5

�ffnungszeiten:
Di, Do 9.00-18.00, Mi, Fr 9.00-15.00

Verkehrsverbindung:
Eichborndamm (S25); Rathaus Reinickendorf (U8); Scharnweberstraße (U6); Landesarchiv (Bus 125, 221)

Best�nde:
Das Universitätsarchiv bewahrt die Bestände von Rektor, Universitätskurator, Universitätsrichter, der Theologischen, Medizinischen, Juristischen und Philosophischen Fakultät sowie der Institute der Friedrich-Wilhelms-Universität seit der Universitätsgründung 1810 bis 1945; die Akten des Rektors, der zentralen Universitätsverwaltung, der Fakultäten/Sektionen der Universität Berlin (ab 1949 Humboldt-Universität zu Berlin), Institute und Kliniken von 1945 bis 1990; die Akten des Präsidenten, der zentralen Universitätsverwaltung sowie der Fakultäten ab 1990 auf. Hier befinden sich auch die Bestände folgender ehemals selbständiger und später in die Universität eingegliederter preußischer Hochschulen und Einrichtungen: Tierärztliche Hochschule (ab 1817), Landwirtschaftliche Hochschule (ab 1882), Forstliche Hochschule Eberswalde (ab 1821), Wirtschaftshochschule Berlin (ab 1905), Charité (ab 1720). Das Universitätsarchiv übernimmt - nach dessen Zuordnung zur Medizinischen Fakultät der Humboldt-Universität - ab Mitte der 1990er Jahre auch die Akten des Virchow-Klinikums. Neben diesen Beständen dokumentiert das Archiv alle Qualifikations- und Beschäftigungsverhältnisse an dieser Universität. Es verfügt über Matrikel, Konzepte der Abgangszeugnisse, Studentenkarteien, Prüfungsakten, Promotions-, Habilitations- und Berufungsverfahren, Personalakten von Wissenschaftlern, eine Bildsammlung sowie über mehr als 140 Nachlässe von Wissenschaftlern dieser Universität. Der Umfang des Archivs beläuft sich auf etwa 7 000 lfm.

Findmittel:
Repertorien, Findkarteien, Spezialinventare.

Ver�ffentlichungen:
Winfried Schultze: Sammeln - Erschließen - Auswerten. Das Archiv der Humboldt-Universität. Geschichte - Aufgaben - Bestände, in: humboldt-spektrum 2, 1995, Heft 4; ders.: Die Bestände des Universitätsarchivs der Humboldt-Universität Berlin und Möglichkeiten ihrer wissenschaftshistorischen Nutzung, in: Jahrbuch für Universitätsgeschichte, Bd. 2, Stuttgart 1999; ders.: Nachlässe im Archiv der Humboldt-Universität zu Berlin. Schriftgut persönlicher Herkunft als Bereicherung der Verwaltungsakten, in: Jahrbuch für Universitätsgeschichte, Bd. 5, Stuttgart 2002.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

KfW Bankengruppe, Konzernarchiv

Name:
KfW Bankengruppe, Konzernarchiv

Kurzname:

Tr�gereinrichtung:

Strasse:
Charlottenstraße 33/33a

Postleitzahl:
10117

Ort:
Berlin

Postanschrift:

Telefon:
(030) 202645253

Telefax:
(030) 202645391

E-Mail:
Lysann.Goldbach@kfw.de

Homepage:
www.kfw.de

Leitung:
Ansprechpartner: Lysann Goldbach

Mitarbeiter(innen):
4

�ffnungszeiten:
nach Vereinbarung

Verkehrsverbindung:
Stadtmitte (U2); Französische Straße (U6); Bus 256

Best�nde:
KfW Bankengruppe ab 1948; Staatsbank Berlin 1990-1994; Sammlung Publikationen und Druckschriften, Foto- und Filmbestand; Numismatische Sammlungen; Ausstellungsobjekte.

Hinweis: Über den Verbleib von Banken vor 1945, die in der SBZ geschlossen wurden, kann das Konzernarchiv Auskunft erteilen.

Findmittel:
Datenbank, Findbücher, Ablieferungslisten.

Ver�ffentlichungen:
Heinrich Harries: Wiederaufbau, Welt und Wende. Die KfW - eine Bank mit öffentlichem Auftrag 1948-1998, Frankfurt am Main 1998; DtA: 1950 - 2000. 50 Jahre Deutsche Ausgleichsbank - Bankgeschäfte und Dienstleistungen im öffentlichen Auftrag, Bonn 2001; DtA: Geschichte und Geschichten. Fünf Jahrzehnte Gründer- und Mittelstandsbank des Bundes. 1950 - 2000, Bonn 2000.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Kreuzberg Museum. Archiv

Name:
Kreuzberg Museum. Archiv

Kurzname:

Tr�gereinrichtung:
Bezirksamt Friedrichshain-Kreuzberg von Berlin

Strasse:
Adalbertstraße 95 A

Postleitzahl:
10999

Ort:
Berlin

Postanschrift:

Telefon:
(030) 50585234

Telefax:
(030) 50585258

E-Mail:
info@kreuzbergmuseum.de

Homepage:
www.kreuzbergmuseum.de

Leitung:
Ulrike Treziak

Mitarbeiter(innen):

�ffnungszeiten:
nach Vereinbarung

Verkehrsverbindung:
Kottbusser Tor (U1, 15, 8); Bus 129, 140

Best�nde:
Schwerpunkte der Sammlung: Sanierungsgeschichte Kreuzbergs, Geschichte der Protestbewegung(en), Migrationsgeschichte, Gewerbegeschichte (mit Schwerpunkt Geschichte des Verlags- und Druckgewerbes), Verkehr und Verkehrsgeschichte. Seit 2001 wird auch zur Geschichte Friedrichshains gesammelt. Zur Sammlung gehören Nachlässe von Kreuzberger Vereinen, Firmen, Familien, statistische Werke, Karten und Pläne von Kreuzberg, Fotosammlung, Bezirkszeitungen, Pressearchiv zu Kreuzberg.

Findmittel:
Verschlagwortung im Archivierungsprogramm ADAD 9.

Ver�ffentlichungen:
Katharina Wiessner: Kreuzberger Notizen, Berlin 2002; Jan Feustel: Verschwundenes Friedrichshain - Bauten und Denkmale im Berliner Osten, Berlin 2001; Klaus Gerhardt: "Die schönste Straße auf der Luisenstadt ist unstreitig die Cöpnicker ...", Berlin 2001; Siedlungsgeschichte des Bezirks Friedrichshain bis 1920, Hrsg.: Heimatmuseum Friedrichshain, Berlin 2001; Kreuzberg in historischen Postkarten. Kreuzberg Museum, Berlin 1997; made in Kreuzberg. Produkte aus Handwerk und Industrie, Hrsg.: Kunstamt Kreuzberg/Kreuzberg Museum, Berlin 1996; 3. Februar 1945. Die Zerstörung Kreuzbergs aus der Luft, Hrsg.: Kunstamt Kreuzberg/Kreuzberg Museum, Berlin 1995; Juden in Kreuzberg. Fundstücke, Fragmente, Erinnerungen, Hrsg.: Berliner Geschichtswerkstatt e.V., Berlin 1991.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Landesamt für Gesundheit und Soziales Berlin. Krankenbuchlager

Name:
Landesamt für Gesundheit und Soziales Berlin. Krankenbuchlager

Kurzname:

Tr�gereinrichtung:

Strasse:
Wattstraße 11-13

Postleitzahl:
13355

Ort:
Berlin

Postanschrift:
Postfach 310929, 10639 Berlin

Telefon:
(030) 46302120

Telefax:
(030) 46302189

E-Mail:
DIETERDURECK@LAGeSo.verwalt-berlin.de

Homepage:

Leitung:
Herr Dureck

Mitarbeiter(innen):
14

�ffnungszeiten:
nach Vereinbarung

Verkehrsverbindung:
Voltastraße (U8)

Best�nde:
Das Krankenbuchlager Berlin, das nach Auflösung der Krankenbuchlager Kassel und München im Jahre 1964 und Übernahme ihrer Krankenurkundenbestände die einzige Institution dieser Art in der Bundesrepublik ist, besteht seit 1952. Ursprünglich als Referat X. ("Archiv für Krankenurkunden der ehemaligen Wehrmacht") Teil der Deutschen Dienststelle (WASt), wurde es am 25.2.1952 als "Krankenbuchlager Berlin" in die Verwaltung der Behörden der Kriegsopferversorgung (KOV) übernommen.
Lazarettkrankenbücher des 1. Weltkrieges und vollständige Verlustlisten (ca. 57 000 Bücher mit 67 Millionen Eintragungen); Lazarettkrankenbücher des 2. Weltkrieges (ca. 29 000 Bücher mit ca. 25 Millionen Eintragungen); Krankenblätter (ca. 11 Millionen).

Findmittel:
42,5 Millionen Karteikarten mit Namen und Geburtsdaten (ab Geburtsjahrgang 1890).

Ver�ffentlichungen:

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Landesarchiv Berlin

Name:
Landesarchiv Berlin

Kurzname:

Tr�gereinrichtung:

Strasse:
Eichborndamm 115-121

Postleitzahl:
13403

Ort:
Berlin

Postanschrift:

Telefon:
(030) 902640

Telefax:
(030) 90264201

E-Mail:
info@larch.verwalt-berlin.de

Homepage:
www.landesarchiv-berlin.de

Leitung:
Direktor des Landesarchivs: Prof. Dr. Uwe Schaper

Mitarbeiter(innen):
77

�ffnungszeiten:
Mo bis Fr 10.00-17.00

Verkehrsverbindung:
Eichborndamm (S 25); Wittenau (S 1); Scharnweberstraße (U 6); Rathaus Reinickendorf (U 8); Landesarchiv (Bus und 221)

Best�nde:
Das Landesarchiv Berlin ist seit 1950 das zentrale Staatsarchiv des Landes Berlin. 1991 wurden das Stadtarchiv Berlin (Ost), dessen Anfänge bis in das 14. Jh. zurückreichten, das Büro für Stadtgeschichtliche Dokumentation und technische Dienste sowie das Verwaltungsarchiv des Magistrats von Berlin mit dem Landesarchiv zu einer Institution vereinigt. 1996 übernahm das Landesarchiv Berlin das Archiv der Deutschen Staatsoper einschließlich des Personals. Seit dem Sommer 2000 gehören auch die Bild-, Film- und Tonarchive der aufgelösten Landesbildstelle Berlin einschließlich des Personals und seit Ende desselben Jahres das Archiv der Internationalen Bauausstellung Berlin (IBA) zum Landesarchiv. Während das Archiv der Deutschen Reichsbahn, Reichsbahndirektion Berlin, bereits 1997 übernommen wurde, gelangte die dazugehörige umfangreiche Karten- und Plankammer erst im Jahre 2001 in das Landesarchiv Berlin. Zur Zeit umfasst das Landesarchiv rund 37 000 lfm Akten, 170 000 Karten und Pläne, 25 000 Plakate, 80 000 Theaterzettel und Programmhefte, 10 500 Notenstücke, 4 000 Ansichten und Porträts, 1 Million Fotos und mehrere Millionen Meter Film- und Tonbandmaterialien sowie eine Dienstbibliothek mit ca. 100 000 Büchern und 12 500 Zeitungs- und Zeitschriftenbänden.
A. Aktenbestände vor 1945 (in Auswahl): Parlamentsschriftgut: Stadtverordnetenversammlung. - Städtische Behörden und nachgeordnete Einrichtungen: Räte zu Berlin und Cölln (bis 1709); Magistrate der mit Berlin vereinigten Städte (bis 1806); Comité administratif; Magistratsverwaltungen und -deputationen; Städtische Baupolizei; Schulen und höhere Lehranstalten. - Bezirksverwaltungen und deren Vorgänger: Magistrate der 1920 eingemeindeten Städte; Amts-, Gemeinde- und Gutsverwaltungen; Bezirksämter; Kommunale Zweckverbände. - Staatliche Behörden: Regierung Berlin; Polizeipräsidium Berlin; Polizeiämter; Preußische Bau- und Finanzdirektion; Oberpost-/Reichspostdirektion Berlin; Reichsbahndirektion Berlin; Heeresversorgungsämter; Landesfinanzamt/Oberfinanzpräsident; Finanzämter; Katasterämter; Standesämter; Arbeitsämter; Stadtpräsident der Reichshauptstadt Berlin; Generalbauinspektor für die Reichshauptstadt; Neubauämter Berlin; Neubauleitungen Berlin-Landwehrkanal und Reichsmünze; Landesleitungen Berlin der Reichskultur-, Reichsmusik-, Reichsschrifttums-, Reichspressekammer und der Reichskammer der Bildenden Künste; Deutsche Staatsoper. - Justizbehörden und -einrichtungen: Landgericht Berlin; Generalstaatsanwaltschaft bei dem Landgericht; Erbgesundheitsgericht; Amtsgerichte; Haftanstalten und Gefängnisse. - Unternehmen: AEG-Teilbetriebe; Bergmann-Elektrizitätswerke AG; Berliner Bürgerbräu AG; A. Borsig Zentralverwaltung GmbH; Deutsche Niles-Werke AG; Garbaty Cigarettenfabrik; Heinrich List-Werke für Elektrotechnik und Mechanik; Loewe Werkzeugmaschinen AG; Osram GmbH; Osthafenmühlen AG; Julius Pintsch KG; Schering AG; Schultheiß-Brauerei AG; Siemens-Planiawerke AG für Kohlefabrikate.- Städtische Eigenbetriebe: Berliner Stadtbank; Sparkasse der Stadt Berlin; Berliner Städtische Wasserwerke; Berliner Städtische Elektrizitätswerke AG (BEWAG); Städtische Vieh- und Schlachthöfe Berlin; Schlachthof Spandau; Berliner Städtische Gaswerke (GASAG). - Organisationen, Verbände und Vereine: Innungen; Gewerberat Berlin; Korporation der Kaufmannschaft von Berlin; Handelshochschule Berlin; Kommunale Spitzenverbände; Frauenverbände und -vereine (Helene-Lange-Archiv); Gewerkschaft der Geistesarbeiter; Kinderrettungsverein (Berliner Stadtmission); Privater Theaterverein "Urania".
B. Aktenbestände Berlin (West) 1945-1990 (in Auswahl): Parlamentsschriftgut: Der Präsident des Abgeordnetenhauses von Berlin; Bezirksverordnetenversammlungen. - Staatliches Schriftgut: Der Regierende Bürgermeister von Berlin/Senatskanzlei; Senatsverwaltungen; Der Polizeipräsident in Berlin; Entnazifizierungsstellen; Einwohnermeldeamt; Entschädigungsamt Berlin; Landesverwaltungsamt Berlin; Notaufnahmelager Marienfelde; Landesamt für Besatzungslasten; Oberfinanzdirektion Berlin; Währungsüberwachungsstelle; Finanzämter; Zollämter; Landesausgleichsamt Berlin; Landesarbeitsamt Berlin; Verkehrsamt; Berliner Feuerwehr; Berliner Forsten; Schulen (u. a. Schulfarm Insel Scharfenberg); Landesbildstelle Berlin; Deutsche Oper Berlin; Staatliche Schauspielbühnen; Hebbel-/Berliner Theater; Freie Volksbühne; Theater des Westens; Berliner Philharmonisches Orchester. - Bezirksverwaltungen: Bezirksämter. - Alliierte und Bundesbehörden: Office of Military Government Berlin Sector (OMGBS); Berliner Kommission für Ansprüche auf Vermögenswerte laut Kontrollrats-Direktive Nr. 50; Oberstes Rückerstattungsgericht für Berlin; Landespostdirektion Berlin. - Justizbehörden und -einrichtungen: Kammergericht Berlin; Generalstaatsanwaltschaft beim Kammergericht; Landgericht Berlin; Staatsanwaltschaft bei dem Landgericht; Amtsgerichte; Justizvollzugsanstalten und Gefängnisse. - Berliner Eigenbetriebe: Berliner Elektrizitätswerke AG (BEWAG); Berliner Hafen- und Lagerhaus-AG (BEHALA); Berliner Wasserbetriebe; Schlachthof Spandau; Stadtgüter; Ausstellungs-, Messe- und Kongress GmbH (AMK); Deutschlandhalle GmbH; Berliner Festspiele GmbH; Kongresshalle Berlin; Kunsthalle Berlin. - Körperschaften: Pädagogische Hochschule Lankwitz; Fachhochschule für Wirtschaft; Pestalozzi-Fröbel-Haus; Deutscher Städtetag. - Verbände und Vereine: Berliner Frauenbund 1945 e.V.; Deutscher Ärztinnenbund e.V.; Humanistische Union; Historische Kommission zu Berlin; Verein Viktoria Studienhaus; Kreuzberger Kulturverein e.V.; Aktionskreis Südost e.V. Kreuzberg; United Restitution Organization (URO) Berlin; GYA-Clubs (German Youth Activities).
C. Aktenbestände Berlin (Ost) 1945-1990 (in Auswahl): Stadtverordnetenversammlung von Berlin. - Stadtverwaltung und nachgeordnete Einrichtungen: Magistrat von Berlin/Oberbürgermeister; Magistratsverwaltungen; Industrieverwaltungen; Hauptplanträger; Chefarchitekt/Büro für Städtebau; Zentrum für Pharmazie und Medizintechnik; Berliner Schulausschuß; Schulen (u. a. Heinrich-Hertz-Oberschule); Schauspielhaus/Konzerthaus; Deutsche Staatsoper; Metropol-Theater; Friedrichstadtpalast; Kabarett "Die Distel"; Maxim-Gorki-Theater; Theater der Freundschaft; Volksbühne; Büro Berliner Festtage; Haus des Lehrers; Pionierpark "Ernst Thälmann"; Archenhold-Sternwarte; Büro für architekturbezogene Kunst. - Bezirksverwaltungen: Räte der Stadtbezirke. - Staatliches Schriftgut: Präsidium der Volkspolizei Berlin; Deutsche Post/Bezirksdirektion Berlin; Deutsche Reichsbahn/Bezirksdirektion Berlin; Staatliche Zentralverwaltung für Statistik/Bezirksstelle Berlin; Bezirkskomitee der Arbeiter- und Bauerninspektion. - Justizbehörden: Kammergericht Berlin (Ost); Generalstaatsanwaltschaft Berlin (Ost); Stadtbezirksgerichte. - Staatliche Wirtschaft: Deutsche Treuhandverwaltung Berlin; Sparkasse der Stadt Berlin; Vereinigungen Volkseigener Betriebe Berlin (VVBB); Vereinigungen Volkseigener Betriebe (VVB), Volkseigene Betriebe und Kombinate. - Kammern: Handels- und Gewerbekammer von Berlin; Handwerkskammer Berlin. - Parteien und Massenorganisationen: Landes- und Bezirksleitung der Sozialistischen Einheitspartei Deutschlands (SED) in Berlin; Kreisleitungen der SED Bezirk Berlin; Grundorganisationen der SED Bezirk Berlin; Nationaldemokratische Partei Deutschlands (NDPD) Bezirksvorstand Berlin; Liberaldemokratische Partei Deutschlands (LDPD) Bezirksvorstand Berlin; Freier Deutscher Gewerkschaftsbund (FDGB) Bezirksvorstand Berlin; Demokratischer Frauenbund Deutschlands (DFD) Bezirksvorstand Berlin; Freie Deutsche Jugend (FDJ) Bezirksvorstand Berlin; Vereinigung der Verfolgten des Naziregimes (VVN); Berliner Friedensrat; Kulturbund der DDR Bezirksvorstand Berlin.
D. Aktenbestände ab 1990: Bestände dieses Zeitabschnittes sind generell noch von der Benutzung ausgenommen.
E. Nachlässe und Personenfonds (Auswahl aus den z. Zt. insgesamt 198 Reposituren): Otto Bach; Paul Baumgarten; Hans von Benda; Peter Bloch; Wilhelm Blume; Gustav Böß; Alexander Dominicus; Adolf Dünnebacke; Kurt Exner; Franz von Göll; Isa Gruner; Hans Habe; Gustav von Hartmann; Arne Hengsbach; Hans E. Hirschfeld; Carl Hirsekorn; Ludwig Hoffmann; Ernst Kaeber; Wilhelm A. Kewenig; Victor Klages; Herbert und Inge Kleusberg; Gustav Klingelhöfer; Heinrich Wilhelm Krausnick; Willy und Brigitte Kressmann; Helene Lange; Gustav Lilienthal; Joachim und Eleonore Lipschitz; Marta Mierendorff; Rudolph Mosse; Oskar Mulert; Marie Munk; Günter Neumann; Walter Nicklitz; Familie Nicolai-Parthey; Louise Otto-Peters; Anna Pappritz; Ernst Reuter; Wilhelm Richter; Louis Friedrich Sachse; John Schikowski; Ingrid Schmidt-Harzbach; Erich Schonert; Johannes Stumm; Otto Suhr; Dorothee von Velsen; Siegmund Weltlinger; Arthur Werner.
F. Sammlungen: Urkunden (13.-20. Jh.); Handschriften (u. a. Chroniken, Edikte, Memoiren, Privilegien); Wappen, Siegel und Medaillen; Karten und Pläne (von Johann Gregor Memhards Plan von 1652 bis zu den neuesten Vermessungen der Senatsverwaltung für Stadtentwicklung, Allgemeine Kartensammlung, Plankammern und Technische Pläne); Plakatsammlung (u. a. Amtliche Bekanntmachungen, Plakate politischer Parteien und Organisationen, Plakate aus den Bereichen Kultur, Kunst, Soziales, Frauen, Religion, Bildung, Bauwesen, Umwelt, Wirtschaft und Werbung); Autographen (u. a. von Wilhelm von Bode, Alexander von Humboldt, Hermann Helmholtz, Max Liebermann, Felix Mendelssohn-Bartholdy, Johann Gottfried Schadow, Samuel Heinrich Spiker, Anton von Werner und Heinrich Zille); Theatergeschichtliche Sammlung (Theaterzettel, Programmhefte, Noten, Kritiken); Sammlung Revolution 1848/49 (u. a. Anschläge, Flugblätter, Ereignisdarstellungen, Karikaturen, Porträts, Revolutionsschriften, Zeitungen); Ansichten und Porträts (u. a. Sammlungen von Anton Balthasar König und Friedrich Nicolai); Postkartensammlung; Fotosammlung (u. a. Fotografien von F. A. Schwartz, G. Bartels, W. Titzenthaler und H. Rückwardt bis zu den neuesten Stadtbildaufnahmen und Porträts durch den eigenen Fotoaufnahmedienst); Filme, Videos und Tonmaterial (u. a. Film- und Tonaufnahmen zur Entwicklung und Geschichte Berlins, Filmporträts und Toninterviews von Personen der Zeitgeschichte durch den eigenen Filmaufnahmedienst); Zeitgeschichtliche Sammlung (u. a. Ausweise, Bürgerbriefe, Fahrkarten, Firmenbriefköpfe, Flugschriften, Lebensmittelkarten, Notgeld, Reklame, Speisekarten, Zeugnisse); Quellensammlung zur Berliner Zeitgeschichte/LAZ (Sammlung der ehemaligen Forschungsstelle für Berliner Zeitgeschichte zu allen Bereichen des öffentlichen Lebens vornehmlich aus den Jahren 1945-1960); Zeitungsausschnittsammlungen.

Findmittel:
Findbücher, Karteien, Datenbanken, Spezialinventare.

Ver�ffentlichungen:
Schriftenreihe zur Berliner Zeitgeschichte, hrsg. im Auftrag des Senats von Berlin, bearb. von der Abt. Zeitgeschichte des Landesarchivs Berlin, Bde. 1-10, Berlin 1957-1981; Berliner Geschichte. Dokumente, Beiträge, Informationen. Schriftenreihe des Stadtarchivs Berlin, 1-11, Berlin 1980-1990; Veröffentlichungen aus den Archiven der Landesbildstelle Berlin, 1-6, Berlin 1975-1994; Ausstellungskataloge des Landesarchivs Berlin, 1-14 , Berlin 1982-1995; Berlin Filme, hrsg. von der Landesbildstelle Berlin und dem Presse- und Informationsamt des Landes Berlin, Berlin 1998; Berlin in Geschichte und Gegenwart. Jahrbuch des Landesarchivs Berlin 1982 ff., Berlin 1982 ff.; Findbücher, hrsg. vom Landesarchiv Berlin, Nrn. 1-31, Berlin 1984-2001; Schriftenreihe des Landesarchivs Berlin, hrsg. von Jürgen Wetzel, Bd. 1: Das Landesarchiv Berlin und seine Bestände, bearb. von Klaus Dettmer u.a., Berlin 1992, Bd. 2: Die Sitzungsprotokolle des Magistrats der Stadt Berlin 1945/46, T. I und II, bearb. von Dieter Hanauske, Berlin 1995 und 1999, Bd. 3: Günther Schulz: Stadtpläne von Berlin 1652 bis 1920, Berlin 1998, Bd. 4: Günther Schulz/Andreas Matschenz: Stadtpläne von Berlin 1652 bis 1920. Tafelband, Berlin 2002, Bd. 5: Heike Schroll: Spurensicherung. Die Bestände des Stadtarchivs Berlin und ihr Schicksal durch den Zweiten Weltkrieg, Berlin 2000; Landesarchiv Berlin. Ein Archiv zwischen gestern, heute und morgen, mit Beiträgen von Jürgen Wetzel, Heike Schroll und Martin Luchterhandt, Berlin 2001.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Landesfachstelle für Archive und öffentliche Bibliotheken im Brandenburgischen Landeshauptarchiv

Name:
Landesfachstelle für Archive und öffentliche Bibliotheken im Brandenburgischen Landeshauptarchiv

Kurzname:

Tr�gereinrichtung:
Ministerium für Wissenschaft, Forschung und Kultur des Landes Brandenburg

Strasse:
An der Orangerie 3

Postleitzahl:
14469

Ort:
Potsdam

Postanschrift:
Postfach 600449, 14404 Potsdam

Telefon:
(0331) 620320 oder (0331) 56740

Telefax:
(0331) 6203216 oder (0331) 5674145

E-Mail:
landesfachstelle@blha.brandenburg.de

Homepage:
www.landeshauptarchiv-brandenburg.de

Leitung:
Direktor: Dr. Klaus Neitmann

Mitarbeiter(innen):

�ffnungszeiten:

Verkehrsverbindung:
Bus 995; Tram 96

Best�nde:
Das Brandenburgische Landeshauptarchiv ist nach dem Gesetz über die Sicherung und Nutzung von öffentlichem Archivgut im Land Brandenburg - Brandenburgisches Archivgesetz vom 7. April 1994 (GVBl I S. 94) das zentrale Archiv des Landes Brandenburg. Seine Zuständigkeit erstreckt sich auf das Archivgut aller Stellen des Landes Brandenburg und ihrer Rechts- und Funktionsvorgänger. Die Zuständigkeit umfasst auch das Archivgut von Reichs- und Bundesbehörden mit ausschließlich regionaler Zuständigkeit im Bereich des Landes Brandenburg. Das 1949 gegründete "Landesarchiv Brandenburg", ab 1951 "Brandenburgisches Landeshauptarchiv" (1965 bis 1990 "Staatsarchiv Potsdam") macht u. a. Urkunden, Amtsbücher, Akten, Karten und Plakate für die Erforschung der brandenburgischen Landes-, Regional-, Lokal- und Familiengeschichte zugänglich, die einen Zeitraum von nahezu 1 000 Jahren geschichtlicher Entwicklung umfassen. Seine vorrangige Aufgabe ist es, die in seiner Obhut befindlichen Unterlagen sicher zu verwahren und dauerhaft zu erhalten, sie durch benutzerfreundliche Findmittel allgemein nutzbar zu machen und auszuwerten. Zugleich ergänzt es seine Bestände ständig um die archivwürdigen Unterlagen, die in den Verwaltungen des Landes Brandenburg entbehrlich geworden sind.

regionale und örtliche Behörden und Einrichtungen der Kurmark, Neumark und Niederlausitz (12. Jh. bis 1815); zentrale, regionale und örtliche Behörden und Einrichtungen der preußischen Provinz Brandenburg sowie regionale und örtliche Behörden und Einrichtungen des Deutschen Reiches im Bereich dieser Provinz (1815 bis 1945); Behörden und Institutionen der brandenburgischen Justizverwaltung (1849 bis 1945), Zentrales Grundbucharchiv

zentrale, regionale und örtliche Behörden und Einrichtungen des Landes Brandenburg (1945 bis 1952); Staatsorgane und wirtschaftleitende Organe der Bezirke Cottbus, Frankfurt (Oder) und Potsdam sowie nachgeordnete Einrichtungen (1952 bis 1990); Parteien und gesellschaftliche Organisationen der Bezirke Cottbus, Frankfurt (Oder) und Potsdam (1945 bis 1989/90), Betriebe und Institutionen der Wirtschaft (1945 bis 1990); nachgeordnete Einrichtungen zentraler Organe der DDR (1945 bis 1990); Behörden und Einrichtungen des Landes Brandenburg (ab 1990)

Die seit dem 1. Januar 2001 dem Brandenburgischen Landeshauptarchiv angegliederte Landesfachstelle für Archive und öffentliche Bibliotheken berät die Unterhaltsträger der Archive und öffentlichen Bibliotheken sowie die Einrichtungen selbst in allen archivischen und bibliothekarischen Fachfragen. Sie unterstützt den Ausbau eines leistungsfähigen Netzes miteinander kooperierender Archive und öffentlicher Bibliotheken in den Landkreisen, kreisfreien Städten und allen anderen Kommunen. Die Landesfachstelle ist die zuständige Stelle für den Ausbildungsberuf der/des Fachangestellten für Medien- und Informationsdienste für den öffentlichen Dienst im Land Brandenburg.

Findmittel:
Findbücher, Findkarteien, Datenbanken

Ver�ffentlichungen:
Schriftenreihen des Archivs:
Veröffentlichungen des Brandenburgischen Landeshauptarchivs; Quellen, Findbücher und Inventare des Brandenburgischen Landeshauptarchivs; Bibliothek der Brandenburgischen und Preußischen Geschichte (gemeinsam mit der Historischen Kommission zu Berlin herausgegeben)
Periodika:
Jahrbuch für die Geschichte Mittel- und Ostdeutschlands (gemeinsam mit der Historischen Kommission zu Berlin herausgegeben); Brandenburgische Archive.Mitteilungen aus dem Archivwesen des Landes Brandenburg (in Zusammenarbeit mit dem VdA-Verband deutscher Archivarinnen und Archivare e. V., Landesverband Brandenburg).

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Landesfachstelle für Archive und öffentliche Bibliotheken im Brandenburgischen Landeshauptarchiv - Außenstelle Frankfurt (Oder)

Name:
Landesfachstelle für Archive und öffentliche Bibliotheken im Brandenburgischen Landeshauptarchiv - Außenstelle Frankfurt (Oder)

Kurzname:

Tr�gereinrichtung:
Ministerium für Wissenschaft, Forschung und Kultur des Landes Brandenburg

Strasse:
Müllroser Chaussee 49

Postleitzahl:
15236

Ort:
Frankfurt (Oder)

Postanschrift:
Landesbehördenzentrum Müllroser Chaussee 49, 15236 Frankfurt (Oder)

Telefon:
(0335) 5601881

Telefax:
(0335) 5601882

E-Mail:
GabrieleKlemke@blha.brandenburg.de

Homepage:
www.landeshauptarchiv-brandenburg.de

Leitung:
Direktor: Dr. Klaus Neitmann

Mitarbeiter(innen):

�ffnungszeiten:
Benutzung nach Absprache

Verkehrsverbindung:

Best�nde:
Das Brandenburgische Landeshauptarchiv ist nach dem Gesetz über die Sicherung und Nutzung von öffentlichem Archivgut im Land Brandenburg - Brandenburgisches Archivgesetz vom 7. April 1994 (GVBl I S. 94) das zentrale Archiv des Landes Brandenburg. Seine Zuständigkeit erstreckt sich auf das Archivgut aller Stellen des Landes Brandenburg und ihrer Rechts- und Funktionsvorgänger. Die Zuständigkeit umfasst auch das Archivgut von Reichs- und Bundesbehörden mit ausschließlich regionaler Zuständigkeit im Bereich des Landes Brandenburg. Das 1949 gegründete "Landesarchiv Brandenburg", ab 1951 "Brandenburgisches Landeshauptarchiv" (1965 bis 1990 "Staatsarchiv Potsdam") macht u. a. Urkunden, Amtsbücher, Akten, Karten und Plakate für die Erforschung der brandenburgischen Landes-, Regional-, Lokal- und Familiengeschichte zugänglich, die einen Zeitraum von nahezu 1 000 Jahren geschichtlicher Entwicklung umfassen. Seine vorrangige Aufgabe ist es, die in seiner Obhut befindlichen Unterlagen sicher zu verwahren und dauerhaft zu erhalten, sie durch benutzerfreundliche Findmittel allgemein nutzbar zu machen und auszuwerten. Zugleich ergänzt es seine Bestände ständig um die archivwürdigen Unterlagen, die in den Verwaltungen des Landes Brandenburg entbehrlich geworden sind.

regionale und örtliche Behörden und Einrichtungen der Kurmark, Neumark und Niederlausitz (12. Jh. bis 1815); zentrale, regionale und örtliche Behörden und Einrichtungen der preußischen Provinz Brandenburg sowie regionale und örtliche Behörden und Einrichtungen des Deutschen Reiches im Bereich dieser Provinz (1815 bis 1945); Behörden und Institutionen der brandenburgischen Justizverwaltung (1849 bis 1945), Zentrales Grundbucharchiv

zentrale, regionale und örtliche Behörden und Einrichtungen des Landes Brandenburg (1945 bis 1952); Staatsorgane und wirtschaftleitende Organe der Bezirke Cottbus, Frankfurt (Oder) und Potsdam sowie nachgeordnete Einrichtungen (1952 bis 1990); Parteien und gesellschaftliche Organisationen der Bezirke Cottbus, Frankfurt (Oder) und Potsdam (1945 bis 1989/90), Betriebe und Institutionen der Wirtschaft (1945 bis 1990); nachgeordnete Einrichtungen zentraler Organe der DDR (1945 bis 1990); Behörden und Einrichtungen des Landes Brandenburg (ab 1990)

Die seit dem 1. Januar 2001 dem Brandenburgischen Landeshauptarchiv angegliederte Landesfachstelle für Archive und öffentliche Bibliotheken berät die Unterhaltsträger der Archive und öffentlichen Bibliotheken sowie die Einrichtungen selbst in allen archivischen und bibliothekarischen Fachfragen. Sie unterstützt den Ausbau eines leistungsfähigen Netzes miteinander kooperierender Archive und öffentlicher Bibliotheken in den Landkreisen, kreisfreien Städten und allen anderen Kommunen. Die Landesfachstelle ist die zuständige Stelle für den Ausbildungsberuf der/des Fachangestellten für Medien- und Informationsdienste für den öffentlichen Dienst im Land Brandenburg.

Findmittel:
Findbücher, Findkarteien, Datenbanken

Ver�ffentlichungen:
Schriftenreihen des Archivs:
Veröffentlichungen des Brandenburgischen Landeshauptarchivs; Quellen, Findbücher und Inventare des Brandenburgischen Landeshauptarchivs; Bibliothek der Brandenburgischen und Preußischen Geschichte (gemeinsam mit der Historischen Kommission zu Berlin herausgegeben)
Periodika:
Jahrbuch für die Geschichte Mittel- und Ostdeutschlands (gemeinsam mit der Historischen Kommission zu Berlin herausgegeben); Brandenburgische Archive.Mitteilungen aus dem Archivwesen des Landes Brandenburg (in Zusammenarbeit mit dem VdA-Verband deutscher Archivarinnen und Archivare e. V., Landesverband Brandenburg).

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Landesgeschichtliche Vereinigung für die Mark Brandenburg e.V. Archiv

Name:
Landesgeschichtliche Vereinigung für die Mark Brandenburg e.V. Archiv

Kurzname:

Tr�gereinrichtung:

Strasse:
Breite Straße 32-36

Postleitzahl:
10178

Ort:
Berlin

Postanschrift:

Telefon:
(030) 90226301 (nur Do 15.00-19.00)

Telefax:
(030) 90226354

E-Mail:
archiv@geschichte-brandenburg.de

Homepage:
www.geschichte-brandenburg.de

Leitung:
Dr. Peter Bahl

Mitarbeiter(innen):
8

�ffnungszeiten:
nach Vereinbarung

Verkehrsverbindung:
Alexanderplatz (S, U); Schlossplatz/Breite Straße (Bus 257)

Best�nde:
Das Archiv der 1884 gegründeten Vereinigung wurde 1960 neben der getrennt geführten, aber räumlich verbundenen Vereinsbibliothek eingerichtet, um außer den seit 1913 durch einen Vereinsarchivar betreuten eigenen Akten der Vereinigung vor allem schriftliche und fotografische Nachlässe sowie die seit 1884 in der Bibliothek verwahrten archivalischen Sammlungen zur brandenburgischen (einschl. Berliner) Landesgeschichte aufzunehmen. Die Sammlungen werden laufend ergänzt. - A. Akten der Vereinigung (seit 1884), u. a.: Korrespondenz, Sachakten, Sitzungsprotokolle, Matrikel. - B. Nachlässe (z. Zt. 52, vorwiegend 20. Jh., insbes. von Landes- und Ortshistorikern, Heimatforschern u. ä.), darunter (Auswahl): Ernst Carsted, Fritz Eichberg, Eberhard Faden, Wolfgang H. Fritze, Felix Havenstein, Arne Hengsbach, Hans-Werner Klünner, Georg Mirow, Adolf Nagel, Hans E. Pappenheim, Waltraud Volk. - C. Sammlungen, insbes.: Druckschriften (Kleinschrifttum), Einzelnummern von Zeitungen, Zeitungsausschnitte (insbes. Orte und Personen, 218 Kartons), Manuskripte, Einzeldokumente und Autographen ("Kleine Erwerbungen"), Siegelmarken, Medaillen und Plaketten, Papiergeld, Landkarten und Pläne; Bildersammlung: ca. 40 000 Fotografien, Ansichtspostkarten, Diapositive, Fotoalben u. a.; Grabstättenbildkarteien Wohlberedt/Michel u. Lüpnitz; Fotografische Nachlässe, u. a. Hans Grantzow, Georg Michel, Wilhelm Reichner; thematische Sammlungen, u. a. zu Grabstätten und Friedhöfen. - D. Deposita: Archiv der Interessengemeinschaft zur Geschichte des Berliner Buchwesens (Vortragsmanuskripte, Diskussionsprotokolle), Archiv der Arbeitsgemeinschaft für die historischen Friedhöfe und Kirchhöfe Berlins e.V. (Erfassungsbögen für Grabstätten bekannter Persönlichkeiten, Fotografien).

Findmittel:
Findbücher und -karteien, Spezialinventar Grabstätten, Generalindex.

Ver�ffentlichungen:
Peter Bahl: Das Archiv der Landesgeschichtlichen Vereinigung für die Mark Brandenburg, in: Landesgeschichtliche Vereinigung für die Mark Brandenburg. Mitteilungsblatt 90, 1989; ders.: Übersicht über die Bestände des Archivs der Landesgeschichtlichen Vereinigung für die Mark Brandenburg, in: Jahrbuch für brandenburgische Landesgeschichte 41, 1990; ders.: Quellen und Literatur zur Kirchengeschichte in Archiv und Bibliothek der Landesgeschichtlichen Vereinigung für die Mark Brandenburg, in: Evangelische Kirche in Berlin-Brandenburg. Archivbericht 6, 1999, 11; jährliche Berichterstattung über Neuerwerbungen im Mitteilungsblatt der Landesgeschichtlichen Vereinigung.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Landeskirchliches Archiv Berlin-Brandenburg - schlesische Oberlausitz

Name:
Landeskirchliches Archiv Berlin-Brandenburg - schlesische Oberlausitz

Kurzname:

Tr�gereinrichtung:

Strasse:
Bethaniendamm 29

Postleitzahl:
10997

Ort:
Berlin

Postanschrift:

Telefon:
(030) 2250450

Telefax:
(030) 22504510

E-Mail:
archiv@ekbo.de

Homepage:
www.bb-evangelisch.de

Leitung:
Dr. Wolfgang Krogel

Mitarbeiter(innen):
10

�ffnungszeiten:
Mo-Do 9.00-16.00, Fr 9.00-14.00

Verkehrsverbindung:
Kottbusser Tor (U1, 15, 8); Bus 140, 265

Best�nde:
Die Bestände umfassen die Archivbestände des Konsistoriums zwischen 1850 und 1945, die Reposituren des Konsistoriums Ost und West bis 1990, kirchlicher Einrichtungen und Werke. Die Archive des Berliner Missionswerks und der Gossner Mission sowie einiger Kirchengemeinden werden mitverwaltet. Zum Archiv gehört auch die Kirchenbuchstelle Berlin-Brandenburg.

Findmittel:
Findmittel liegen in gedruckter Form vor. Finddatenbanken sind im Lesesaal zu benutzen. Die Findmittel werden ständig ergänzt.

Ver�ffentlichungen:
Jahrbuch für Berlin-Brandenburgische Kirchengeschichte (zuletzt erschienen Band 64); Archivberichte (zuletzt erschienen Band 14/15); Beihefte zu den Archivberichten, Ns. 1-100.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Lila Archiv e.V.

Name:
Lila Archiv e.V.

Kurzname:

Tr�gereinrichtung:

Strasse:
Choriner Straße 9

Postleitzahl:
10119

Ort:
Berlin

Postanschrift:

Telefon:
(030) 4492289

Telefax:
(030) 4492289

E-Mail:
lilaarchiv@freenet.de

Homepage:
www.lilaarchiv.de

Leitung:
Dr. Ursula Sillge

Mitarbeiter(innen):

�ffnungszeiten:
nach Vereinbarung

Verkehrsverbindung:
Rosa-Luxemburg-Platz (U2); Rosenthaler Platz (U8); Bus 143, 340; Tram 13, 50, 53

Best�nde:
Archivalien zur Situation der Geschlechter in der Gesellschaft, zur widerständigen Bewegung in der DDR und Osteuropa, eine umfangreiche Sammlung von Frauenbiografien, mehrere Nachlässe; einmalige Dokumente, Bücher, Fotos, Plakate, Buttons, Zeitschriften, Zeitschriftenausschnitte, Mikrofilme, Tonträger, Videos.

Findmittel:
Alphabetische und systematische Kataloge, Datenbank.

Ver�ffentlichungen:
Miss Marples Schwestern (Broschüre über frauenrelevante Stadtführungen im deutschsprachigen Raum).

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Matthias Domaschk Archiv

Name:
Matthias Domaschk Archiv

Kurzname:

Tr�gereinrichtung:
Robert-Havemann-Gesellschaft e. V.

Strasse:
Schliemannstraße 23 (Quergebäude)

Postleitzahl:
10437

Ort:
Berlin

Postanschrift:

Telefon:
(030) 44710820

Telefax:
(030) 44710829

E-Mail:
archive@havemann-gesellschaft.de

Homepage:
www.havemann-gesellschaft.de

Leitung:
Frank Ebert, Anne Vogel, Olaf Weißbach, Tom Sello

Mitarbeiter(innen):
4

�ffnungszeiten:
nach Vereinbarung

Verkehrsverbindung:
Eberswalder Straße (U2); Schönhauser Allee und Prenzlauer Allee (S4, 8, 85); Tram 1, 13

Best�nde:
Das Archiv wurde im Januar 1992 als unabhängige Einrichtung der Berliner Umwelt-Bibliothek gegründet, die sich in den achtziger Jahren zu einem Zentrum der Gegenöffentlichkeit in der DDR entwickelt hatte. 1993 schloss sich das Matthias Domaschk Archiv der Robert-Havemann-Gesellschaft e.V. an. Arbeitsschwerpunkte sind die Dokumentation von Opposition und widerständigem Verhalten in der DDR anhand der überlieferten Selbstzeugnisse sowie die Verfolgung oppositioneller Gruppen und Einzelpersonen durch die Staatssicherheit und andere repressive Institutionen und Organisationen der DDR.
I. Bestand Opposition: Persönliche Archivbestände u. a. von Roland Jahn, Heiko Lietz, Lutz Peter Naumann, Gerd Poppe, Ulrike Poppe, Reinhard Schult, Hans Jochen Tschiche; Gruppenbestände: Überlieferungen von über achtzig oppositionellen Gruppen, darunter Arbeitskreis Solidarische Kirche, Arbeitsgruppe Frieden in der Mecklenburgischen Landeskirche, Berliner Umwelt-Bibliothek, Friedenskreis Berlin-Friedrichsfelde, Grün-Ökologisches Netzwerk Arche, Initiative Frieden und Menschenrechte, Berliner Samariter-Gemeinde u. a.; Samisdat-Schriften, Plakate und gegenständliche Zeugnisse der Opposition; Thematische Sammlungen u. a. zu illegalen Radiosendern, zur Besetzung der MfS-Zentrale 1990 mit Schrift-, Film- und Tondokumenten sowie Materialien zur Entstehung des Stasi-Unterlagengesetzes.
II. Bestand Repression: Kopien von MfS-Akten zu oppositionellen Personen und Gruppen, die Betroffene nach ihrer Akteneinsicht in der Behörde der Bundesbeauftragten für die Stasi-Unterlagen dem Archiv zur Nutzung übergeben haben; Grundlagenmaterial und Dienstanweisungen zu einzelnen Abteilungen des MfS und der Juristischen Hochschule Potsdam. Eine Pressedokumentation wird zu den Arbeitsschwerpunkten des Archivs geführt. Mit dem Robert-Havemann-Archiv (siehe dort) besteht seit 1993 eine arbeitsteilige Kooperation. Dies führte zur Bildung gemeinsam betreuter Bestände, um die Nutzung zu vereinfachen und Doppelarbeit zu vermeiden. Hierzu gehören das Fotoarchiv mit ca. 15 000 Aufnahmen, das Video- und Audioarchiv mit ca. 5 600 Video- und 350 Audiokassetten und die Präsenzbibliothek mit ca. 5 000 Buch- und Zeitschriftentiteln.

Findmittel:
Datenbanken und Verzeichnisse.

Ver�ffentlichungen:
Wendezeiten 1990/91. Kontraste auf den Spuren einer Diktatur. CD-ROM. SFB-Redaktion "Kontraste" in Zusammenarbeit mit dem Matthias Domaschk Archiv, Berlin 2000.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Mitte Museum am Gesundbrunnen

Name:
Mitte Museum am Gesundbrunnen

Kurzname:

Tr�gereinrichtung:
Bezirksamt Mitte von Berlin

Strasse:
Pankstraße 47

Postleitzahl:
13357

Ort:
Berlin

Postanschrift:

Telefon:
(030) 4606019-0

Telefax:
(030) 4606019-29

E-Mail:

Homepage:
www.mittemuseum.de

Leitung:
Kerstin Sittner-Hinz

Mitarbeiter(innen):
3

�ffnungszeiten:
So – Mi: 10 – 17 Uhr, Do: 10 – 20 Uhr Öffnungszeiten Archiv / Bibliothek: Mo, Di, Do: 10-16 Uhr Nutzung von Archiv, Bibliothek, Sammlung nach Terminvereinbarung unter Tel. 4606019-25/-23

Verkehrsverbindung:
S-Bhf. Gesundbrunnen (S1, S2, S25, Ring) U-Bhf. Pankstraße (U8) Bus: M 27

Best�nde:
Wiss. Spezialbibliothek, Dokumente, Fotografien, Ansichtskarten, Plakate, Karten und Pläne der früheren Heimatmuseen von Mitte, Wedding und Tiergarten, audiovisuelle Sammlung, Nachlass Bruno Stephan (1893-1982), Zeitungsausschnittsammlung, Einladungen, Plakate und Veröffentlichungen des Kunstamts Wedding (1950-2000), Bestand Schenkung 46. Infanterieregiment der französischen Besatzungsmacht, Akten des Kunstamts Tiergarten (1949-1990).

Findmittel:
Bibliothekskatalog (alphabetisch und systematisch), Digitaler Katalog im Aufbau, Eingangsbuch, Schlagwortregister (Zeitungsausschnittsammlung, Fotosammlung), Verzeichnis der Provenienzen (Fotosammlung), Verzeichnis der Fotografen, Inventarkartei.

Ver�ffentlichungen:
Christine von Oertzen, Gabriele Jäger: Boulevard Badstraße. Großstadtgeschichte im Berliner Norden, Berlin 1993; Marion Melk-Koch: Schulen im Wedding 1821-1995, Berlin 1995; Sigrid Schulze: Heimatmuseum Berlin-Wedding. Zur Inventarisierung eines regionalgeschichtlichen Fotobestandes, in: Rundbrief Fotografie Nr. 2, 1998. Schriftenreihe des Museums Mitte Hefte: 1 - 7

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Museum für Kommunikation. Bibliothek

Name:
Museum für Kommunikation. Bibliothek

Kurzname:

Tr�gereinrichtung:
Deutsche Post und Deutsche Telekom, Museumsstiftung Post und Telekommunikation

Strasse:
Leipziger Straße 16

Postleitzahl:
10117

Ort:
Berlin

Postanschrift:

Telefon:
(030) 20294300

Telefax:
(030) 20294111

E-Mail:
i.krause@mspt.de

Homepage:
www.museumsstiftung.de

Leitung:
Irmgard Krause

Mitarbeiter(innen):
3

�ffnungszeiten:
Di-Fr 9.00-17.00

Verkehrsverbindung:
Mohrenstraße (U2); Stadtmitte (U2, 6); Bus 148, 348, TXL

Best�nde:
Die Bibliothek des Museums für Kommunikation ist eine Spezialbiblothek zur Kommunikationsgeschichte, einschließlich der Post- und Fernmeldegeschichte und der Philatelie mit ca. 70 000 Büchern und Zeitschriftenbänden. Eine umfangreiche Sammlung von Archivalien, Formularen, Telegrammen, Dokumenten und Akten zur Post- und Fernmeldegeschichte ist der Bibliothek angeschlossen. Die Bücher und Zeitschriften sind den Besuchern und Besucherinnen in einem Freihandbereich zugänglich und können im Lesesaal eingesehen oder auch ausgeliehen werden. Archivalien werden zur Einsicht im Lesesaal zur Verfügung gestellt.

Findmittel:
Die Bestände sind teilweise elektronisch mit dem Bibliotheksverwaltungsprogramm LARS erfasst und teilweise über einen traditionellen Zettelkatalog und verschiedene Findbücher erschlossen.

Ver�ffentlichungen:
Irmgard Krause: Die Bibliothek des Postmuseums, in: Katalog zur Briefmarkenausstellung Berolina 93, Berlin 1993; ...einfach würdiger Styl. Vom Reichspostmuseum zum Museum für Kommunikation, Berlin 2000.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Museum im Wasserwerk

Name:
Museum im Wasserwerk

Kurzname:

Tr�gereinrichtung:
Berliner Wasserbetriebe

Strasse:
Müggelseedamm 307

Postleitzahl:
12587

Ort:
Berlin

Postanschrift:

Telefon:
(030) 86447695

Telefax:
(030) 86447746

E-Mail:
info@museum-im-wasserwerk.de (museum@bwb.de)

Homepage:
www.museum-im-wasserwerk.de (www.bwb.de)

Leitung:
Jelena Butter

Mitarbeiter(innen):
1

�ffnungszeiten:
nach Vereinbarung, Tel.: (030) 86447612

Verkehrsverbindung:
Friedrichshagen (S3); Tram 60

Best�nde:
Das Museum im Wasserwerk ist eine Einrichtung der Berliner Wasserbetriebe. Es sammelt, bewahrt, erschließt und dokumentiert als das größte Unternehmensmuseum Berlins Zeugnisse der Wasserversorgung und Stadtentwässerung Berlins. Die Sammlungen umfassen derzeit rund 24 000 Pläne und Zeichnungen, ca. 100 lfm Akten und Einzeldokumente. Der gegenständliche Bereich umfasst ca. 7 000 Einzelstücke. Dazu gehören Maschinen, Maschinenteile, Werkzeuge, Geräte, Bodenfunde, Laborgeräte, Textilien, Plakate, Orden und einige Grafiken.
Das Bildarchiv stellt dabei eine wertvolle und einzigartige Spezialsammlung dar. Es enthält ca. 50 000 Bildträger (Originalabzüge, Neuabzüge, Glasnegative, Originalnegative, Lichtdrucke, Großformatdias, Diapositive, Kontaktabzüge, Reproduktionen, Postkarten).
Die Sammlung ist in die Bereiche Trinkwasserversorgung, Abwasserentsorgung, Nachlässe und Spezialsammlungen untergliedert. Es handelt sich dabei vorwiegend um Fotos von Wasserwerken, Abwasserpumpwerken, Rieselfeldern, Klärwerken, vom Bau der Kanalisation, Wassertürmen und dem Rohrnetz. Die Fotos dokumentieren auch den Arbeitsalltag von Arbeitern und Angestellten.
Das Bildarchiv besitzt eine komplexe Auftragssammlung von Hermann Rückwardt und Friedrich Albert Schwartz über den Bau von Wasserwerken und eine Auftragssammlung von Reinhold Lissner zu Abwasserpumpwerken. Unikate stellen mehr als fünf Fotoalben mit Aufnahmen vom Bau der Kanalisation unter der U- und S-Bahn dar. Bodenfunde bei Bauarbeiten wurden ebenso dokumentiert wie Aufnahmen, die Rückschlüsse auf Bautechnik, Baufirmen und Bautechnologien zulassen. Zeitlich reichen die Aufnahmen von den frühen achtziger Jahren des 19. Jahrhunderts bis zur Gegenwart.

Findmittel:
Als Findmittel dient die computergestützte Datenbank GOS nach Knorr. Eine Kartei nach Schlagworten und Provenienz der Stücke wird zur Zeit erarbeitet. Weiterhin gibt es ein Listensystem zur Zuordnung der noch nicht inventarisierten Fotos.

Ver�ffentlichungen:
Hilmar Bärthel: Wasser für Berlin, Berlin 1997; Historische Beiträge. Eine Schriftenreihe der Berliner Wasserbetriebe 1-5, Berlin 1995-1997; Günter Kley: Wasserwerk Friedrichshagen, Berlin 1993; Günter Rudolf: Alte Pumpwerke in Berlin, Berlin 1987; Jelena Butter: Ein Archiv im Aufbau - Das Historische Archiv der Berliner Wasserbetriebe im Museum im Wasserwerk, in: Archiv und Wirtschaft, 30. Jahrgang 1992, Heft 2; Hilmar Bärthel: Geklärt - 125 Jahre Berliner Stadtentwässerung, Berlin 2003.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Museum Neukölln

Name:
Museum Neukölln

Kurzname:

Tr�gereinrichtung:
Bezirksamt Neukölln, Abteilung Bildung, Schule, Kultur und Sport, Amt für Weiterbildung und Kultur, Fachbereich Kultur/ Museum Neukölln

Strasse:
Alt-Britz 81

Postleitzahl:
12359

Ort:
Berlin

Postanschrift:

Telefon:
(030) 627 277 727, (030) 627 277 725 (Archiv)

Telefax:

E-Mail:
info@museum-neukoelln.de; Archiv: geschichtsspeicher@museum-neukoelln.de

Homepage:
www.museum-neukoelln.de

Leitung:
Udo Gößwald (Leitung), Julia Dilger (Archiv)

Mitarbeiter(innen):
3

�ffnungszeiten:
Di-So 10.00-18.00

Verkehrsverbindung:
Parchimer Allee (U7), Fulhamer Allee (Bus M44, M46)

Best�nde:
Fotoarchiv, Postkarten, Medien (Tondokumente, Filme, Videos), Dokumente, thematische Spezialarchive, Objekte; Sammlungsschwerpunkt Rixdorf/Neukölln, Alltags- und Kulturgeschichte; Spezialarchive: Mosaikwerkstätten Puhl & Wagner, Schularchiv (Reformschulen); Widerstand; Jüdisches Leben; Jahn-Archiv; Kirchengeschichte; Musik- und Theatergeschichte; Filmproduktion (Geyer-Kopierwerk), Vor- und Frühgeschichte, naturkundliche Sammlung (Reste).

Findmittel:
Computergestützte Recherche, Handkataloge (kein Freihandarchiv). Nutzung nur nach Terminabsprache; Archivanfragen per Mail oder telefonisch.

Ver�ffentlichungen:
Romeo und Julia in Neukölln. Begleitband zur gleichnamigen Ausstellung im Heimatmuseum, 17.5.2002-6.4.2003, hrsg. von Udo Gößwald im Auftrag des Bezirksamts Neukölln von Berlin, Abteilung Bildung, Schule und Kultur, Kulturamt/Heimatmuseum, Berlin 2002; Made in Neukölln. Wirtschaft im Umbruch. Begleitband zur gleichnamigen Ausstellung im Heimatmuseum, 13.5.2001-6.4.2002, hrsg. von Udo Gößwald im Auftrag des Bezirksamts Neukölln von Berlin, Abteilung Bildung, Schule und Kultur, Kulturamt/Heimatmuseum, Berlin 2001; Der erste Schrei oder Wie man in Neukölln zur Welt kommt. Begleitband zur gleichnamigen Ausstellung im Heimatmuseum, 13.5.2000-1.4.2001, hrsg. von Udo Gößwald im Auftrag des Bezirksamts Neukölln von Berlin, Abteilung Bildung, Schule und Kultur, Kulturamt/Heimatmuseum, Berlin 2000; Immer wieder Heimat: 100 Jahre Heimatmuseum Neukölln. Begleitband zur Ausstellung Immer wieder Heimat, 100 Jahre Heimatmuseum Neukölln, 1.10.1997-4.10.1998, Heimatmuseum Neukölln, hrsg. von Udo Gößwald im Auftrag des Bezirksamts Neukölln von Berlin, Abt. Bildung und Kultur, Kulturamt/Heimatmuseum, Opladen 1997.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Parlamentsarchiv des Deutschen Bundestages

Name:
Parlamentsarchiv des Deutschen Bundestages

Kurzname:

Tr�gereinrichtung:
Deutscher Bundestag

Strasse:
c/o Marie-Elisabeth-Lüders-Haus
Nordallee / Schiffbauerdamm

Postleitzahl:
10117

Ort:
Berlin

Postanschrift:
Platz der Republik 1, 11011

Telefon:
(030) 22732319, 22732320

Telefax:
(030) 22736817

E-Mail:
vorzimmer.wd3@bundestag.de

Homepage:
www.bundestag.de/bic/archiv/index.html

Leitung:
N.N., kommissarisch: Bernd Wahlers

Mitarbeiter(innen):
28

�ffnungszeiten:
Mo-Do 9.00-16.00, Fr 9.00-13.00

Verkehrsverbindung:
Friedrichstraße (U6); S1, S2, S25, S5, S7, S75, S9; Karlplatz (Bus TXL)

Best�nde:
Drucksachen und Stenographische Berichte des Reichstages des Norddeutschen Bundes 1867-1870, des Deutschen Zollparlaments April/Mai 1868, des Deutschen Reichstags 1871-1945 und der Verfassunggebenden Nationalversammlung 1919/1920; Nachkriegsbehörden 1945-49 (jeweils nur Bestandsteile): Zonenbeirat, Wirtschaftsrat, Büro der Ministerpräsidenten, Parlamentarischer Rat; Deutscher Bundestag seit 1949: Plenum, Ausschüsse und sonstige parlamentarische Gremien (außer Vermittlungsausschuss), Verwaltung des Deutschen Bundestages Audiovisuelle Aufzeichnungen der Plenardebatten (bis 1990/91 nur Ton, 1991 bis 1995 Ton und teilweise Video, ab 1995 Video); ca. 80.000 Fotos und Bilder, seit 2003 digital; Dokumentationen zu den verabschiedeten Bundesgesetzen; Parteiprogramme der beim Bundewahlleiter registrierten Parteien; Wahlkampfmaterial zu Bundestagswahlen (v. a. Plakate).

Findmittel:
Findbücher zu den Beständen Zonenbeirat, Wirtschaftsrat, Büro der Ministerpräsidenten, Parlamentarische Rat; Abgabelisten und Findkarteien zum Bestand Deutscher Bundestag; Findkartei zum Bildbestand; Findbücher zu den Aufzeichnungen der Plenardebatten.

Ver�ffentlichungen:
Periodische Veröffentlichungen:
Amtliches Handbuch des Deutschen Bundestages. Herausgegeben vom Deutschen Bundestag. Neue Darmstädter Verlagsanstalt. Rheinbreitbach.
Veröffentlichung diverser Gesetzesmaterialien und Fundstellennachweise zu den Gesetzesmaterialien der Bundesgesetze.
Bekanntmachung der öffentlichen Liste über die Registrierung von Verbänden und deren Vertretern. Bundesanzeiger. Herausgegeben vom Bundesministerium der Justiz.

Sonstige Veröffentlichungen:
Der Parlamentarische Rat 1948 - 1949. Akten und Protokolle. Hrsg. vom Deutschen Bundestag und vom Bundearchiv. Harald Boldt Verlag Boppard / Oldenbourg Verlag München.
Wörtliche Berichte und Drucksachen des Wirtschaftsrates des Vereinigten Wirtschaftsgebietes 1947 - 1949. Hrsg. vom Institut für Zeitgeschichte und dem Deutschen Bundestag, Wissenschaftliche Dienst. R. Oldenbourg Verlag München Wien 1977.
Günther Weller. Das Archiv des Deutschen Bundestages. In: Mitteilungen der Parlamentsarchivare. Nr. 5 / 5. Oktober 1981. S. 21.
Ders. Das Archiv des Deutschen Bundestages. In: Der Archivar 38 (1985). Sp. 79-89.
Kurt Georg Wernicke. Parlamentsdokumentation in Bonn. In: Die Dokumentation in der Bundesrepublik Deutschland - Rückblicke in ihren Aufbruch. München 1991.
Angela Ullmann. Der lange Weg nach Berlin. Das Parlamentsarchiv des Deutschen Bundestages bereitet sich auf den Umzug vor. In: Der Archivar 55 (2002), H. 3, S. 233-234.
Angela Ullmann. Das Parlament in Pixeln. Digitale Fotos als neue Herausforderung. Chemnitz 2003. URL http://www.uni-muenster.de/Forum-Bestandserhaltung/downloads/ullmann.pdf.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Polizeihistorische Sammlung

Name:
Polizeihistorische Sammlung

Kurzname:

Tr�gereinrichtung:
Der Polizeipräsident in Berlin

Strasse:
Platz der Luftbrücke 6

Postleitzahl:
12101

Ort:
Berlin

Postanschrift:

Telefon:
(030) 4664994762

Telefax:
(030) 4664904199

E-Mail:
ppr.phs@snafu.de

Homepage:
www.polizei.berlin.de

Leitung:
Dr. Bärbel Schönefeld

Mitarbeiter(innen):
6 ehrenamtliche

�ffnungszeiten:
Mo-Mi 9.00-15.00, für Gruppen nur nach Anmeldung Mo-Fr nach Vereinbarung; Benutzung der Dokumenten- und Fotoablage nur nach telefonischer Voranmeldung

Verkehrsverbindung:
Platz der Luftbrücke (U6); Bus 104, 119, 341

Best�nde:
Dokumente, Fotos und Sekundärquellen zur Berliner Polizeigeschichte im Wesentlichen für den Zeitraum nach 1945; Präsenzbibliothek mit polizeihistorischem Schwerpunkt.

Findmittel:

Ver�ffentlichungen:
Berliner Polizei - 1945 bis zur Gegenwart, Jaren-Verlag 1998; Broschurreihe "Erlebte Polizeigeschichte" 1. Titel: Besondere Lage: Mauerfall, Eigendruck 2000, 2. Titel: Wiedervereinigung-Vereinigte Polizei in Berlin, Eigendruck 2003, 3. Titel: Der Volksaufstand in Ostberlin und der DDR, Eigendruck 2004.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Prenzlauer Berg Museum. Archiv

Name:
Prenzlauer Berg Museum. Archiv

Kurzname:

Tr�gereinrichtung:
Bezirksamt Pankow von Berlin
Amt für Kultur und Bildung

Strasse:
Prenzlauer Allee 227

Postleitzahl:
10405

Ort:
Berlin

Postanschrift:

Telefon:
(030) 90295-3911, -3917

Telefax:
(030) 902953918

E-Mail:

Homepage:

Leitung:
Bernt Roder

Mitarbeiter(innen):
2

�ffnungszeiten:
Di 8.00-13.00, Do 13.00-18.00

Verkehrsverbindung:
Senefelder Platz (U2); Tram 1

Best�nde:
Das Fotoarchiv besitzt ca. 30 000 Aufnahmen von der Jahrhundertwende bis zur Gegenwart (Aufnahmen von Autorenfotografen und aus Privatbesitz). Die Fotobestände behandeln die Genres Architekturfotografie (Schulgebäude um 1900), Alltagsszenen, Portraits, Kriegsschäden, öffentliche Feiern, Privatfotos und Aufnahmen der sog. alternativen Szene in Prenzlauer Berg. Das Dokumentenarchiv verfügt über unterschiedliche Quellen zur Geschichte des Prenzlauer Bergs, darunter Karten und Pläne, Nachlässe, Betriebschroniken und Sammlungen zu thematischen Aspekten wie z. B. Gewerbegeschichte, politische Geschichte und jüdische Geschichte. Außerdem ist eine umfangreiche Präsenzbibliothek und eine Zeitungsausschnittsammlung vorhanden.

Findmittel:
Teilweise vorhanden, Fotoarchiv teilweise EDV-erfasst.

Ver�ffentlichungen:

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

PTS - PS - Information Center Corporate History & Archives Schering Archives / Schering History

Name:
PTS - PS - Information Center Corporate History & Archives Schering Archives / Schering History

Kurzname:

Tr�gereinrichtung:
Bayer Business Services GmbH

Strasse:
Müllerstr. 170/171

Postleitzahl:
13342

Ort:
Berlin

Postanschrift:
Schering Archiv, Geb. M021, 13342 Berlin

Telefon:
(030) 46812171

Telefax:
(030) 46815225

E-Mail:
thore.grimm@bayer.com

Homepage:
www.BayerBBS.com

Leitung:
Thore Grimm

Mitarbeiter(innen):
2

�ffnungszeiten:
nach Vereinbarung

Verkehrsverbindung:
Wedding (S); Wedding (U6)

Best�nde:
Ca. 2 km Akten, Pläne, Fotos, Filme und Exponate aus der Geschichte der Schering AG, ihrer Vorläufer und Nachfolgeunternehmen wie Grüne Apotheke, Chemische Fabrik auf Actien (vorm. E. Schering), C. A. F. Kahlbaum, Oberschlesische Kokswerke & Chemische Fabriken AG, Schering-Kahlbaum AG, deren Beteiligungen und Sparten (Pharma, Foto, Kosmetik, Industriechemikalien, Feinchemikalien, Pflanzenschutz, Galvanotechnik, Kohle/Koks).

Findmittel:
Findbücher, Datenbanken.

Ver�ffentlichungen:
Historischer Jahresstrang "Von der Grünen Apotheke zum globalen Pharmaunternehmen", 9. Aufl., 2001; Hans-Jürgen Hamann: Die Schering AG 1945 bis 1949. Ein Unternehmen kämpft um sein Überleben, 1990; Aus einem Jahrhundert Schering-Forschung - Pharma, 1991; Ernst Schering. Reisen 1876-1878. Tagebücher, 2001; Aus Berlin in alle Welt. Die Schering AG 1949-1971, 1998, Schering 1971-1993. Ein Unternehmen im strategischen Wandel, 2005.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Robert-Havemann-Archiv

Name:
Robert-Havemann-Archiv

Kurzname:

Tr�gereinrichtung:
Robert-Havemann-Gesellschaft e.V.

Strasse:
Schliemannstraße 23 (Quergebäude)

Postleitzahl:
10437

Ort:
Berlin

Postanschrift:

Telefon:
(030) 44710810

Telefax:
(030) 44710819

E-Mail:
archive@havemann-gesellschaft.de

Homepage:
www.havemann-gesellschaft.de

Leitung:
Tina Krone, Andreas Otto, Werner Theuer

Mitarbeiter(innen):
2

�ffnungszeiten:
Di-Do 9.30-15.30 (nur nach vorheriger Vereinbarung)

Verkehrsverbindung:
Eberswalder Straße (U2); Schönhauser Allee und Prenzlauer Allee (S4, 8, 85); Tram 1, 13

Best�nde:
Das Archiv wurde 1992 von der Robert-Havemann-Gesellschaft gegründet und 1994 eröffnet. Arbeitsschwerpunkte sind die Dokumentation der Biographie Robert Havemanns und der Geschichte der Bürgerbewegung, die sich ab 1989 in der DDR herausbildete.
I. Persönliche Archivbestände: Nachlass Robert Havemanns und entsprechende Ergänzungsdokumentation mit Volksgerichtshof-, SED- u. MfS-Akten, Sammlungen aus dem Familien- und Freundeskreis, Film- und Tonmaterial; Archivbestände von Persönlichkeiten der Bürgerbewegung, u. a. von Marianne Birthler, Bärbel Bohley, Klaus Freymuth, Jan Hermann, Christiane Ziller.
II. Gruppenbestände der Bürgerbewegung: Neues Forum (Archivgut der Bundesgeschäftsstelle, des Berliner Landesverbandes sowie Unterlagen einzelner Landes- und Regionalverbände, Transparente, Plakate, Aufkleber, Film- u. Tonmaterial sowie Ergänzungsdokumentation aus MfS-Unterlagen); Bündnis 90, Demokratie Jetzt, Demokratischer Aufbruch, Grüne Liga, Grüne Partei, SDP, Vereinigte Linke u. a. (Schriftgut, Film- u. Tonmaterial); Runde Tische (Schriftgut und Videoaufzeichnungen der Sitzungen des zentralen Runden Tisches sowie Unterlagen zu regionalen und thematischen Runden Tischen); Zeitungen der Bürgerbewegung, u. a. die Berliner Wochenzeitung "die andere" einschließlich des Redaktionsarchivs.
III. Bestand "Illegale Bibliothek" (überlieferte Sammlung von in der DDR verbotener Literatur mit ca. 700 Bänden, die eine Ostberliner Gruppe seit den siebziger Jahren für den illegalen Verleih aufgebaut hatte).
IV. Archiv GrauZone zur unabhängigen Frauenbewegung in der DDR (Korrespondenzen, Aufrufe, Flugblätter, Berichte und persönliche Aufzeichnungen aus über 100 Frauengruppen, Unterlagen des Unabhängigen Frauenverbandes [UFV] von 1989 bis 1998 sowie Periodika, Plakate, Fotos und Filmmaterial). Eine personen- und themenbezogene Pressedokumentation wird zu den Arbeitsschwerpunkten des Archivs geführt. Mit dem Matthias Domaschk Archiv Berlin (siehe dort), das sich 1993 der Robert-Havemann-Gesellschaft angeschlossen hat, besteht eine arbeitsteilige Kooperation. Dies führte zur Bildung gemeinsam betreuter Bestände, um die Nutzung zu vereinfachen und Doppelarbeit zu vermeiden. Hierzu gehören das Fotoarchiv mit ca. 15 000 Aufnahmen, das Video- und Audioarchiv mit ca. 5 600 Video- und 350 Audiokassetten und die Präsenzbibliothek mit ca. 5 000 Buch- und Zeitschriftentiteln.

Findmittel:
Datenbanken und Verzeichnisse.

Ver�ffentlichungen:
Schriftenreihe des Robert-Havemann-Archivs: Bd 1: Silvia Müller u. Bernd Florath: Die Entlassung. Robert Havemann und die Akademie der Wissenschaften 1965/66, Berlin 1996; Bd. 2: Martin Morgner: Deckname "Maske". Die Künstlergemeinschaft Mecklenburg 1980/81, Berlin 1995; Bd. 3: Siegfried Reiprich: Der verhinderte Dialog. Meine politische Exmatrikulation. 2. Aufl., Berlin 2001; Bd. 4: Tina Krone: "Sie haben so lange das Sagen, wie wir es dulden." Briefe an das Neue Forum September 1989 bis März 1990, Berlin 1999; Bd. 5: Christof Geisel u. Christian Sachse: Wiederentdeckung einer Unperson. Robert Havemann im Herbst 89, Berlin 2000; Bd. 6: Simone Hannemann: Robert Havemann und die Widerstandsgruppe "Europäische Union", Berlin 2001; Bd. 7: Ilko-Sascha Kowalczuk: Freiheit und Öffentlichkeit. Politischer Samisdat in der DDR 1985-1989; Berlin 2002; Bd. 8: Sandra Pingel-Schliemann: Zersetzen. Strategie einer Diktatur, Berlin 2002.
Außerhalb der Schriftenreihe: Tina Krone, Irena Kukutz und Henry Leide: Wenn wir unsere Akten lesen. Handbuch zum Umgang mit den Stasi-Akten. 2., erweiterte Aufl., Berlin 1997; Friederike Freier: Das Robert-Havemann-Archiv in Berlin, in: Deutschland Archiv, 27. Jg., 1994, H. 8, S. 790-792; Werner Theuer: Die archivalische Überlieferung der Bürgerrechtsgruppen der DDR in den Archiven der Robert-Havemann-Gesellschaft e.V., in: Archive und Gesellschaft. Referate des 66. Deutschen Archivtags 1995 in Hamburg. Der Archivar, Beiband 1, 1996, S. 116-128; ders.: Die Besonderheiten und Leistungen der unabhängigen Archive am Beispiel des Robert-Havemann-Archivs und des Matthias Domaschk Archivs, in: Horch und Guck, 6. Jg., 1997, H. 21, S. 37-42; Bernd Florath: Die Archive der Robert-Havemann-Gesellschaft, in: IWK, 32. Jg., 1996, H. 4, S. 535-538; Hubertus Knabe: Wo liegen die Selbstzeugnisse der DDR-Opposition? Zugänge zu einem schwierigen Forschungsgebiet, in: Deutschland Archiv, 30. Jg., 1997, H. 4, S. 565-571; Andreas Otto: Die Robert-Havemann-Gesellschaft mit den Archiven Robert-Havemann-Archiv und Matthias Domaschk Archiv, in: Potsdamer Bulletin für Zeithistorische Studien, 1997, Nr. 11, S. 41-46.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Rock-ZAS – Zeitungsausschnittsammlung Pop, Rock, Punk, Metal, Gothic, Industrial

Name:
Rock-ZAS – Zeitungsausschnittsammlung Pop, Rock, Punk, Metal, Gothic, Industrial

Kurzname:
Rock-ZAS

Tr�gereinrichtung:
privat

Strasse:
Exerzierstraße 24

Postleitzahl:
13357

Ort:
Berlin

Postanschrift:
Rock-ZAS, Wolfgang Lux, Exerzierstraße 24, 13357 Berlin

Telefon:
[bitte nur E-Mail]

Telefax:
[bitte nur E-Mail]

E-Mail:
rock-zas@arcor.de
info@rock-zas.de

Homepage:
www.rock-zas.de

Leitung:
Wolfgang Lux

Mitarbeiter(innen):
Leiter + 1 studentische Hilfskraft

�ffnungszeiten:
nach Voranmeldung Mo 13.00 – 17.00 Uhr, Sa 8.00 – 12.00 Uhr oder nach Absprache an anderen Tagen

Verkehrsverbindung:
Osloer Straße (U8, U9, M13, Tram 50)

Best�nde:
Schwerpunkt Material: Zeitungsausschnitte, Musikmagazine, Musikbücher, Promo-Material, Musik-Tonträger, Musik-Bildträger (sowie vereinzelt andere Materialien)

Schwerpunkt Stil: Pop, Rock, Punk, Metal, Gothic, Industrial (aber auch andere Stile)

Schwerpunkt Zeitraum: 1984 – 2006 (vereinzelt auch früher bzw. später)

Schwerpunkt Erschließung: Die Zeitungsausschnitte und das Promo-Material genießen Priorität; wenige sind noch nicht systematisiert, noch keine bibliografiert. Von den Musikmagazinen sind einige Jahrgänge ausgewertet (verzettelt), viele nicht. Die Ton- und Bildträger werden nicht diskografiert, sondern nur ihr Vorhandensein angezeigt (siehe Datenbank).

Findmittel:
Datenbank

Ver�ffentlichungen:

Schlagw�rter:
Musik, Rock, Pop, Zeitungsausschnitte

Archivtyp:
Zeitungsausschnittsammlung

Bild:

xxxxxx

Rudower Heimatverein e.V.

Name:
Rudower Heimatverein e.V.

Kurzname:

Tr�gereinrichtung:

Strasse:
Alt-Rudow 60

Postleitzahl:
12355

Ort:
Berlin

Postanschrift:
Schriftsetzerweg 19 B, 12355 Berlin

Telefon:
(030) 6623662

Telefax:
(030) 6623662

E-Mail:

Homepage:

Leitung:
Manfred Ziemer

Mitarbeiter(innen):
2

�ffnungszeiten:
nach Vereinbarung

Verkehrsverbindung:
Rudow (U7)

Best�nde:
Landkarten aus Rudow, Neukölln, Berlin, Deutschland; Literatur aus Rudow, Neukölln, Berlin, Brandenburg und Deutschland; Fotos und Dias aus Rudow, Neukölln, Berlin und Brandenburg; Gegenstände aus Hausrat, Handwerk und Landwirtschaft.

Findmittel:
Literatur im PC.

Ver�ffentlichungen:

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Rundfunk Berlin-Brandenburg
Archive und Dokumentation

Name:
Rundfunk Berlin-Brandenburg
Archive und Dokumentation

Kurzname:

Tr�gereinrichtung:

Strasse:
Masurenallee 8-14

Postleitzahl:
14057

Ort:
Berlin

Postanschrift:

Telefon:
(030) 97993-54000, -54001

Telefax:
(030) 9799354009

E-Mail:
dokumentation-archive@rbb-online.de

Homepage:
www.rbb-online.de

Leitung:
Frank Dürr

Mitarbeiter(innen):
65

�ffnungszeiten:
9.00-17.00 (keine öffentlichen Öffnungszeiten)

Verkehrsverbindung:
Kaiserdamm (U12, 2); Theodor-Heuss-Platz (U12, 2), Eichkamp (Messe) (S)

Best�nde:
Tonträger: Wort, Musik und Film (Fernsehen), teilweise digital als Audiofiles und nur im Intranet verfügbar; Presse: ausgewählte Ganzstücke und Artikel, seit April 1999 ausschließlich digital und nur im Intranet verfügbar; Bibliotheksbestand: Monographien, Fortsetzungswerke, Loseblattsammlungen, Graue Literatur etc. mit Sondersammelgebiet Musik, Noten. Programm-Mitschnittdienst bietet Umschnitte von Hörfunk- und Fernsehbeiträgen unter www.rbb.de verlinkt zu "Werbung".

Findmittel:
Dezentrale Verbund-Datenbanken der ARD: Wosad, Musad, Planet inkl. Online-Ausleihe, Venus-Agenturen-DB, Presto (Munzinger) und OPAC (Bibliotheca 2000) zentral verfügbar im Intranet. Darüber hinaus Digitaler Audiospeicher DigAs, ausschließlich intern.

Ver�ffentlichungen:

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

S-Bahn Berlin GmbH. Archiv

Name:
S-Bahn Berlin GmbH. Archiv

Kurzname:

Tr�gereinrichtung:

Strasse:
Adlergestell 143

Postleitzahl:
12439

Ort:
Berlin

Postanschrift:

Telefon:
(030) 29728001

Telefax:
(030) 29727088

E-Mail:
Gabriele.Wartenberg@s-bahn-berlin.de

Homepage:

Leitung:
Frau Wartenberg

Mitarbeiter(innen):
2

�ffnungszeiten:
nach Vereinbarung

Verkehrsverbindung:
Betriebsbahnhof Schöneweide (S45, 46, 8, 9)

Best�nde:
Archivgut, Registraturgut, Dienstvorschriften, Personalakten, Lohnakten, Gesundheitsakten, Lagepläne/Zeichnungen, Fotos, Verträge, Sammlungen.

Findmittel:
PC.

Ver�ffentlichungen:

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Spinnboden Lesbenarchiv

Name:
Spinnboden Lesbenarchiv

Kurzname:

Tr�gereinrichtung:

Strasse:
Anklamer Straße 38

Postleitzahl:
10115

Ort:
Berlin

Postanschrift:

Telefon:
(030) 4485848

Telefax:
(030) 22495582

E-Mail:
spinnboden@spinnboden.de

Homepage:
www.spinnboden.de

Leitung:
Sabine Balke, Esther Lopez

Mitarbeiter(innen):
2 hauptamtliche Mitarbeiterinnen

�ffnungszeiten:
Mi, Fr 14.00-19.00 und nach Vereinbarung

Verkehrsverbindung:
Bernauer Straße (U8)

Best�nde:
Die internationale Präsenzbibliothek und die Dokumentensammlung umfassen über 10 000 Bücher, ca. 900 Zeitschriftentitel, über 500 Videofilme, wissenschaftliche Abschlussarbeiten, Plakate sowie Bild- und Tonträger zur Lesbengeschichte und -bewegung. Wir bieten Fundamentales und Rares zur Freundinnenkultur der zwanziger Jahre, Dokumente des Berliner Lesbischen Aktionszentrums (LAZ), kontroverse Standpunkte feministischer Theoriebildung sowie private Sammlungen mit Papieren und Erinnerungsstücken aller Art.

Findmittel:

Ver�ffentlichungen:

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

St. Nikolai Kirchengemeinde Spandau. Archiv und Bibliothek

Name:
St. Nikolai Kirchengemeinde Spandau. Archiv und Bibliothek

Kurzname:

Tr�gereinrichtung:

Strasse:
Reformationsplatz 12

Postleitzahl:
13597

Ort:
Berlin

Postanschrift:

Telefon:
(030) 3338054

Telefax:
(030) 3338039

E-Mail:
museum@nikolai-spandau.de

Homepage:
www.nikolai-spandau.de

Leitung:
Sabine Müller

Mitarbeiter(innen):
1

�ffnungszeiten:
nach Vereinbarung

Verkehrsverbindung:
Altstadt Spandau (U7)

Best�nde:
Akten des Kirchenkreises Spandau, Schriften, Pläne, Dokumente etc. vom 14. Jh. bis heute.

Findmittel:
Zettelkartei und Datenbank.

Ver�ffentlichungen:

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Staatliche Museen zu Berlin Preußischer Kulturbesitz. Kunstbibliothek

Name:
Staatliche Museen zu Berlin Preußischer Kulturbesitz. Kunstbibliothek

Kurzname:

Tr�gereinrichtung:

Strasse:
Matthäikirchplatz 6

Postleitzahl:
10785

Ort:
Berlin

Postanschrift:

Telefon:
(030) 2662029

Telefax:
(030) 2662958

E-Mail:
kb@smb.spk-berlin.de

Homepage:
www.smb.spk-berlin.de

Leitung:
Prof. Dr. Bernd Evers

Mitarbeiter(innen):
59

�ffnungszeiten:
Mo-Fr 9.00-20.00

Verkehrsverbindung:
Potsdamer Platz (S1, 2, 25, U2); Bus 129, 148, 200, 348

Best�nde:
Umfassende kunstwissenschaftliche Bibliothek, museale Sammlungen und einige archivartige Sammlungen, darunter Architekten- und Kunsthistorikernachlässe, Fotografien.

Findmittel:
Kataloge und Verzeichnisse.

Ver�ffentlichungen:

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Staatliche Museen zu Berlin Preußischer Kulturbesitz. Zentralarchiv

Name:
Staatliche Museen zu Berlin Preußischer Kulturbesitz. Zentralarchiv

Kurzname:

Tr�gereinrichtung:
Staatliche Museen zu Berlin - Stiftung Preußischer Kulturbesitz

Strasse:
Bodestraße 1-3

Postleitzahl:
10178

Ort:
Berlin

Postanschrift:

Telefon:
(030) 20906201

Telefax:
(030) 20906002

E-Mail:
za@smb.spk-berlin.de

Homepage:
zur Zeit noch in der Entwicklung

Leitung:
Dr. Jörn Grabowski

Mitarbeiter(innen):
3

�ffnungszeiten:
Mo 12.00-16.00, Di-Fr 9.00-16.00 (allgemein zugänglich, nach Vereinbarung)

Verkehrsverbindung:
Hackescher Markt (S, Tram); Lustgarten (Bus 100, 157, 348)

Best�nde:
Nachdem bereits 1830 und 1930 wiederholt Versuche gescheitert waren, ein Archiv auf der Museumsinsel einzurichten, gelang es erst zu Beginn der 60er Jahre, eine zentrale Einrichtung zu schaffen, die sich der Sicherung des Archivgutes widmen konnte. Parallel zu diesen Bemühungen wurde 1962 das Archiv der Nationalgalerie und in den 70er Jahren das Archiv der Bauverwaltung gegründet. 1987 wurden die drei Archive zu einem Zentralarchiv auf der Museumsinsel zusammengeführt. Das Zentralarchiv verwahrt Geschäftsakten, Vereins- und Kommissionsunterlagen, Nachlässe und archivische Sammlungen der Museen und Verwaltungseinrichtungen der ehemals Königlichen, heute Staatlichen Museen zu Berlin - Preußischer Kulturbesitz. Zu den wichtigsten Beständen (Auswahl) gehören die weitgehend vollständigen Hausregistraturen der Nationalgalerie und des Kaiser-Friedrich-Museums (heute Bodemuseum) mit den Geschäftsakten der Frühchristlich-Byzantinischen Sammlung, der Gemäldegalerie, des Islamischen Museums, des Münzkabinetts und der Skulpturensammlung. Vorhanden sind große Teile der Registraturen der Generalverwaltung und der Bauverwaltung, dabei eine Plankammer (16 000 Baupläne) sowie Reste der Registratur der Königlichen Kunstkammer, der Abteilungsregistraturen der Antikensammlung, des Ägyptischen Museums/Papyrussammlung, des Kupferstichkabinetts, des Staatlichen Museums für Deutsche Volkskunde, der Museumsbibliothek und des Vorderasiatischen Museums. Neuere Akten (ab 1945) werden aus den Museen und Verwaltungseinrichtungen kontinuierlich übernommen, verzeichnet und erschlossen. Zum Archivbestand gehören weiterhin Teile der Registraturen des Kaiser-Friedrich-Museums-Vereins, des Vereins der Freunde der Nationalgalerie, des Vereins zur Erhaltung des Kunsthistorischen Instituts in Florenz und der Kunstgeschichtlichen Gesellschaft zu Berlin. Darüber hinaus führt das Zentralarchiv verschiedene archivische Sammlungen (Auswahl): Autographensammlung (Künstlerbriefe des 19. und 20. Jhs.), Fotosammlung historischer Gebäude- und Raumaufnahmen der Museen, Künstlerdokumentation zur Kunst des 19. und 20. Jhs. (Fotos, Drucksachen und Zeitungsausschnitte), Spezialdokumentationen zur Assoziation Revolutionärer Bildender Künstler Deutschlands (ASSO), zur Geschichte der Sammlung der Moderne im ehemaligen Kronprinzen-Palais und zur Aktion "Entartete Kunst" 1937 sowie eine Dokumentation der kriegsbedingt verlagerten und vermissten Sammlungsgegenstände der Museen.

Findmittel:
Karteien, Findbücher und Datenbanken.

Ver�ffentlichungen:
Annegret Janda: Schriftliche Quellen zur bildenden Kunst des 19. und 20. Jhs., in: Forschungen und Berichte 20/21 (1980), S. 421-450; Friedrich Künzel: Quellen zur Museums- und Kunstgeschichte. Die Geschichte und die Bestände des Zentralarchivs auf der Museumsinsel, in: Jahrbuch der Berliner Museen 1992, Neue Folge, Bd. 34, S. 195-208; Jörn Grabowski: Die Akten der Nationalgalerie im Zentralarchiv der SMPK (1874-1945), in: Museums Journal, Nr. IV, Oktober 2001, S. 26-30; Bestandsverzeichnisse hrsg. von Jörn Grabowski, Band 1: Wilhelm von Bode. Verzeichnis des schriftlichen Nachlasses, bearb. von Friedrich Künzel unter Mitarbeit von Barbara Götze, Berlin 1995, Band 2: Die Akten der Nationalgalerie 1874-1945. Findbuch, bearb. von Barbara Götze, Petra Ettinger und Jörn Grabowski, Berlin 2001.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Staatliches Institut für Musikforschung Preußischer Kulturbesitz mit Musikinstrumenten-Museum

Name:
Staatliches Institut für Musikforschung Preußischer Kulturbesitz mit Musikinstrumenten-Museum

Kurzname:

Tr�gereinrichtung:

Strasse:
Tiergartenstraße 1

Postleitzahl:
10785

Ort:
Berlin

Postanschrift:

Telefon:
(030) 254810

Telefax:
(030) 25481172

E-Mail:
sim@sim.spk-berlin.de

Homepage:
www.sim.spk-berlin.de

Leitung:
Dr. Thomas Ertelt, Prof. Dr. Conny Restle

Mitarbeiter(innen):
z. Zt. 52

�ffnungszeiten:
Musikinstrumenten-Museum Di-Fr 9.00-17.00, Sa-So 10.00-17.00;
Bildarchiv Mo-Do 9.00-15.00, Fr 9.00-12.00;
Bibliothek und Handschriften Di-Do 10.00-17.00, Fr 10.00-12.00

Verkehrsverbindung:
Potsdamer Platz (S, U2); Bus 129, 148, 200, 248, 348

Best�nde:
Die Bibliothek des SIM umfasst ca. 67 000 Bände und 460 Mikroformen. Der Bestand ist überwiegend frei zugänglich. Die Sammelschwerpunkte sind nach den im Institut durchgeführten Forschungsprojekten ausgerichtet: Musiktheorie, Musikgeschichte, Musikinstrumentenkunde und Systematische Musikwissenschaft. Es werden ca. 150 Zeitschriften laufend vorgehalten. Als Sondersammlung mit eigener Signatur besitzt das SIM die Musikbibliothek des Musikkritikers und -schriftstellers Hans Heinz Stuckenschmidt. Außerdem beherbergt es das Archiv der Berliner Philharmoniker mit vielfältigen Materialien zu deren Geschichte seit 1882.
Die Tonträgersammlung des SIM, bestehend aus ca. 2 500 Black Discs (Langspielplatten und Schellackplatten) und ca. 500 Compact Discs, darunter u. a. Schallplatten der Labels DGG - Archiv Produktion und Teldec - Das Alte Werk, ist eine Präsenzsammlung und dient in erster Linie internen Forschungszwecken. Der Schwerpunkt der Sammlung liegt bei historisierenden Interpretationen auf sogenannten Originalinstrumenten.
Ferner besitzt das SIM ein Handschriftenarchiv mit ca. 650 Musikmanuskripten (davon 320 Autographen) und über 4600 Musikerbriefen, u. a. aus den Nachlässen von Joseph Joachim und Franz Wüllner.
Die Fotokopiensammlung des Instituts ist zwischen den beiden Weltkriegen am Staatlichen Institut für deutsche Musikforschung, einer Vorgängereinrichtung des SIM, angelegt worden. Sie geht auf eine Initiative Max Seifferts zurück, der während des Ersten Weltkrieges begonnen hatte, musikalisches Quellenmaterial aus den Beständen des Brüsseler Conservatoires auf fotografischem Wege zu reproduzieren. Durch Kriegswirren und Verlagerung in die Sowjetunion infolge des Zweiten Weltkriegs ist die Sammlung nicht mehr vollständig erhalten. Zu ihrem Bestand gehören fotografische Wiedergaben von durch den Krieg verlorengegangenen Quellen wie etwa das Plauener Orgelbuch.
Das Bildarchiv mit über 80 000 Dokumenten verwahrt umfangreiches Material zum eigenen Instrumentenbestand. Die kommerzielle Verwertung der Fotografien unterliegt dem Bildarchiv PK. Daneben dokumentieren zahlreiche Gemälde, Kupfer- und Stahlstiche, Lithografien und Originalzeichnungen den historischen Instrumentenbau und historische Aufführungspraktiken. Ergänzt wird der Bestand durch Fotos von Fremdinstrumenten, Reproduktionen wichtiger Persönlichkeiten der Musikgeschichte, die Instrumenten- und Instrumentenbauerkartei von Friedrich Ernst, die Glasplattensammlung der Potsdamer Orgelbaufirma Schuke, den Nachlass des Berliner Geigenbauers Alfred Leicht und ausgewählte Patentschriften zum Musikinstrumentenbau.

Findmittel:
Kataloge, Karteien, Listen, Inventare. Elektronische Erschließung unter http://opac.sim.spk-berlin.de (Bücher und Zeitschriften) sowie http://kalliope.staatsbibliothek-berlin.de/ (Handschriften und Nachlässe) im Aufbau.

Ver�ffentlichungen:
Veröffentlichungen des Staatl. Instituts f. Musikforschung PK, 1967 ff.; Jahrbuch des Staatl. Instituts f. Musikforschung PK, 1968 ff.; Bibliographie des Musikschrifttums, 1960 ff.; Geschichte der Musiktheorie, 1984 ff.; Briefwechsel der Wiener Schule, 1995 ff.; Studien zur Geschichte der Musiktheorie, 2001 f.; Kielklaviere, Cembali, Spinette, Virginale. Bestandskatalog, Berlin 1991; Neuerwerbungen 1993-1994. 10 Jahre Musikinstrumenten-Museum am Kulturforum, Berlin 1994; Das Berliner "Bach-Cembalo". Ein Mythos und seine Folgen, Berlin 1995; Thomas Lerch: Vergleichende Untersuchung von Bohrungsprofilen historischer Blockflöten des Barock, Berlin 1996; Olga Adelmann und Annette Otterstedt, die Alemannische Schule. Geigenbau des 17. Jh. im südlichen Schwarzwald und in der Schweiz, Berlin 1997; Die Sing-Akademie zu Berlin und ihre Direktoren, Berlin 1998; D. Droysen-Reber: Harfen des Berliner Musikinstrumenten-Museums. Bestandskatalog, Berlin 1999; Faszination Klavier - 300 Jahre Pianofortebau in Deutschland, München 2000; Richard Strauss im kaiserlichen Berlin, Berlin 2001; "In aller Munde": Mundharmonika - Handharmonika - Harmonium: Eine 200-jährige Erfolgsgeschichte. Berlin 2002; Andreas Meyer, Ullrich Scheideler (Hrsg.): Autorschaft als historische Konstruktion: Arnold Schönberg - Vorgänger, Zeitgenossen, Nachfolger und Interpreten. Stuttgart, Weimar 2001. CD-Reihen "Klingendes Museum" und "Klingendes Museum live".

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Staatsbibliothek zu Berlin Preußischer Kulturbesitz. Handschriftenabteilung

Name:
Staatsbibliothek zu Berlin Preußischer Kulturbesitz. Handschriftenabteilung

Kurzname:

Tr�gereinrichtung:
Stiftung Preußischer Kulturbesitz

Strasse:
Unter den Linden 8, 10117 Berlin (Haus 1), Potsdamer Straße 33, 10785 Berlin (Haus 2)

Postleitzahl:

Ort:

Postanschrift:
10102 Berlin (Haus 1), 10772 Berlin (Haus 2)

Telefon:
(030) 2662841 (Sekretariat), 2662847 (Lesesaal), 2661354 (Inkunabel-Lesesaal)

Telefax:
(030) 2662842

E-Mail:
handschriftenabt@sbb.spk-berlin.de

Homepage:
http://handschriften.staatsbibliothek-berlin.de/

Leitung:
Dr. Eef Overgaauw

Mitarbeiter(innen):
40

�ffnungszeiten:
Mo-Fr 9.00-17.00, Sa 9.00-13.00

Verkehrsverbindung:
Haus 1: Friedrichstraße (S, U6); Bus 100, 348; Tram 1, 50
Haus 2: Potsdamer Platz (S, U2); Bus 129, 148, 200, 248, 348

Best�nde:
18 278 mittelalterliche und neuere Handschriften, 600 Urkunden, 729 Nachlässe und Archive, 239 800 Autographe, 4 360 Inkunabeln, 479 600 Einblattdrucke, Porträts, Theaterzettel und Exlibris.
Das Referat Inkunabeln mit der Redaktion des Gesamtkatalogs der Wiegendrucke befindet sich im Haus 1.
Die Handschriftenabteilung verwaltet das historische Archiv der Staatsbibliothek.

Findmittel:
Bandkataloge, gedruckte Kataloge (s. Veröffentlichungen), Zettelkataloge.
Online-Angebot gedruckter Kataloge der Handschriftenabteilung: http://handschriften.staatsbibliothek-berlin.de/de/abendlaendische_handschriften/kataloge.php, Online-Verbunddatenbanken mit Beständen der Handschriftenabteilung: http://www.manuscripta-mediaevalia.de/ (mittelalterliche Handschriften) http://kalliope.staatsbibliothek-berlin.de/ (Autographen/Nachlässe)

Ver�ffentlichungen:
Staatsbibliothek zu Berlin Preußischer Kulturbesitz. Kataloge der Handschriftenabteilung, R 1: Handschriften 1, 1979 ff., R 2: Nachlässe 1, 1979 ff., R 3: Illuminierte Handschriften 1, 1991 ff.; Gesamtkatalog der Wiegendrucke, hrsg. von der Staatsbibliothek zu Berlin Preußischer Kulturbesitz, Bd. 10: Gratia Dei - Hierocles, Stuttgart 2001; Tilo Brandis: Die Wiedervereinigung der Handschriftenabteilung, in: Schätze wieder vereint. Die Zusammenführung der historischen Sonderabteilungen der Staatsbibliothek zu Berlin Preußischer Kulturbesitz, Wiesbaden 1999, S. 124-143; Aderlass und Seelentrost: die Überlieferung deutscher Texte im Spiegel Berliner Handschriften und Inkunabeln (Ausstellungskataloge der Staatsbibliothek zu Berlin - Preußischer Kulturbesitz N.F. 48), Peter Jörg Becker; Eef Overgaauw (Hrsg.), Mainz 2003.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Staatsbibliothek zu Berlin Preußischer Kulturbesitz. Kartenabteilung

Name:
Staatsbibliothek zu Berlin Preußischer Kulturbesitz. Kartenabteilung

Kurzname:

Tr�gereinrichtung:
Stiftung Preußischer Kulturbesitz

Strasse:
Unter den Linden 8, 10117 Berlin (Haus 1), Potsdamer Straße 33, 10785 Berlin (Haus 2)

Postleitzahl:

Ort:

Postanschrift:
10102 Berlin (Haus 1), 10772 Berlin (Haus 2)

Telefon:
(030) 2661309 (Haus 1), 2662422 (Haus 2)

Telefax:
(030) 2661392 (Haus 1), 2663010 (Haus 2)

E-Mail:
kartenabt.udl@sbb.spk-berlin.de (Haus 1), kartenabt@sbb.spk-berlin.de (Haus 2)

Homepage:
Staatsbibliothek-Berlin.de/deutsch/abteilungen/kartenabteilung/index.html

Leitung:
Wolfgang Crom

Mitarbeiter(innen):
21

�ffnungszeiten:
Haus 1: Mo-Fr 9.00-19.00, Haus 2: Mo-Fr 9.00-17.00, Sa 9.00-13.00

Verkehrsverbindung:
Haus 1: Friedrichstraße (S, U6); Bus 100, 200, 348; Tram 50
Haus 2: Potsdamer Platz (S, U2); Bus 129, 148, 200, 248, 348

Best�nde:
951 000 Karten, 29 000 Atlanten, 154 000 Bildansichten, 168 Globen, 1 600 CD-ROMs, 33 500 Bde. kartographisches Schrifttum. Der Altbestand an Karten (bis Erscheinungsjahr 1939) befindet sich im Haus Unter den Linden, der moderne Bestand mit den umfangreichen topographischen Kartenwerken, der elektronischen Kartographie sowie dem Schwerpunkt der kartographischen Literatur im Haus Potsdamer Straße.

Findmittel:
Alphabetische Kataloge, regionale Kataloge, systematische bzw. Schlagwortkataloge, Altkartendatenbank (gedruckte Karten bis 1850) auch elektronisch verfügbar: ikar.sbb.spk-berlin.de.

Ver�ffentlichungen:
Berlin-Brandenburg im Kartenbild. Wie haben uns die anderen gesehen? Wie haben wir uns selbst gesehen? Staatsbibliothek zu Berlin, hrsg. von Wolfgang Scharfe..., Wiesbaden 2000; Bibliographia Cartographica. Internationale Dokumente des kartographischen Schrifttums, München; Wolfgang Crom: IKAR. Migration und Fortführung der Altkartendatenbank, in: Bibliotheksdienst 3, 2002; Karten der Welt - Welt der Karten. Die Kartenabteilung der Staatsbibliothek in Berlin 1971-2000. Materialsammlung für eine Chronik, bearb. von Christian Dornburg, Berlin 2000; Kartographische Sammlungen in Berlin. Geschichte, Standorte, Informationen, hrsg. von Lothar Zögner, Gotha 2001; Lothar Zögner: Kartenschätze. Aus den Sammlungen der Staatsbibliothek zu Berlin, hrsg. von Antonius Jammers, Braunschweig 2000.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Staatsbibliothek zu Berlin Preußischer Kulturbesitz. Mendelssohn-Archiv

Name:
Staatsbibliothek zu Berlin Preußischer Kulturbesitz. Mendelssohn-Archiv

Kurzname:

Tr�gereinrichtung:

Strasse:
Unter den Linden 8

Postleitzahl:
10117

Ort:
Berlin

Postanschrift:

Telefon:
(030) 2661257

Telefax:
(030) 2661624

E-Mail:
musikabt@sbb.spk-berlin.de

Homepage:

Leitung:
N.N. (Vertretung: Dr. Helmut Hell)

Mitarbeiter(innen):
1

�ffnungszeiten:
Mo-Fr 9.00-19.00, Sa 9.00-13.00

Verkehrsverbindung:
Friedrichstraße (S, U6); Bus 100, 200, 348; Tram 1, 50

Best�nde:
a) Geschichte: Gründung des Archivs 1964 durch eine Stiftung von Hugo von Mendelssohn Bartholdy. b) Art der Bestände: Bücher, Musikalien, Briefe, Handschriften und Bilder zur Geschichte der Familien Mendelssohn, Mendelssohn Bartholdy und Hensel.
Bibliothek: Handbibliothek mit 3 600 Bden., davon 1 600 Bde. Musikalien.

Findmittel:
Kataloge; Gedruckte Bestandsübersicht: Hans-Günter Klein, Das Mendelssohn-Archiv der Staatsbibliothek zu Berlin, Berlin 2003.

Ver�ffentlichungen:
Rudolf Elvers und Hans-Günter Klein: Die Mendelssohns in Berlin. Eine Familie und ihre Stadt (Ausstellungskatalog), Berlin 1983; Hans-Günter Klein: 25 Jahre Mendelssohn-Archiv, in: Jahrbuch Preußischer Kulturbesitz 26, 1990, S. 333-345; Cécile Lowenthal-Hensel: Wilhelm Hensel 1794-1861 (Ausstellungskatalog), Wiesbaden 1994; Hans-Günter Klein: Die Mendelssohns in Italien (Ausstellungskatalog), Wiesbaden 2002.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Stadtgeschichtliches Museum Spandau. Archiv

Name:
Stadtgeschichtliches Museum Spandau. Archiv

Kurzname:

Tr�gereinrichtung:
Bezirksamt Spandau von Berlin

Strasse:
Am Juliusturm

Postleitzahl:
13599

Ort:
Berlin

Postanschrift:
Zitadelle, 13599 Berlin

Telefon:
(030) 354944287

Telefax:
(030) 354944296

E-Mail:

Homepage:

Leitung:
Dr. Joachim Pohl

Mitarbeiter(innen):
2

�ffnungszeiten:
Di 9.00-15.00, Mi 10.30-17.30, Fr 9.00-14.00

Verkehrsverbindung:
Zitadelle oder Altstadt Spandau (U7); Bus 133

Best�nde:
Das Archiv des Stadtgeschichtlichen Museums setzt die Tradition des ehemaligen Spandauer Stadtarchivs fort, dessen Bestände es verwahrt, soweit sie über den Zweiten Weltkrieg gerettet werden konnten. Seit 1983 besteht es als öffentlich zugängliches Archiv im Dachgeschoss des Palas auf der Zitadelle Spandau. Neben den Beständen des Stadtarchivs verfügt es über umfangreiche Sammlungen, die vor allem seit den 1970er Jahren hinzugekommen sind. Kommunales Schriftgut: Urkundensammlung, Amtsbücher, Akten des Spandauer Magistrats. Nichtkommunales Schriftgut: Spandauer Presse, Ansichten- und Fotosammlung, Kartensammlung, Sammlung Ludewig, Firma Florian, Fischersozietät Tiefwerder-Pichelsdorf. Sonstiges: Siegelstempel, Medaillen und Münzen. Dienstbibliothek: Schwerpunkte Spandauer Lokalgeschichte, Berlin und Brandenburg, Militärgeschichte.

Findmittel:
Findbücher, Findkarteien.

Ver�ffentlichungen:
Edmund Schneider: Das Stadtarchiv Spandau, in: Mitteilungen des Vereins für die Geschichte Berlins 77 (1981), S. 272-274; Joachim Pohl: Das Archiv des Stadtgeschichtlichen Museums Spandau, in: 40 Jahre Kreis der Freunde und Förderer des Heimatmuseums Spandau, Berlin 1994, S. 46-55; Joachim Pohl: Vom Rathausgewölbe mit eisernen Türen zum Archiv des Stadtgeschichtlichen Museums Spandau, in: Spandauer Notizen, Jahresausgabe 2002/2003, S. 79-87; Gerhard Hinz: Kriegsverluste des Stadtgeschichtlichen Museums Spandau, in: Spandauer Notizen, Jahresausgabe 2002/2003, S. 89-91; Joachim Pohl mit einem Beitrag von Fritz Meyerling: Schatzkammer Archiv - Kostbarkeiten aus dem Archiv des Stadtgeschichtlichen Museums Spandau vorgestellt anlässlich des 50-jährigen Bestehens der Heimatkundlichen Vereinigung Spandau 1954 e.V., in: Festschrift zur 50-Jahrfeier 1954-2004. Spandauer Notizen, Jahresausgabe 2004, S. 97-177.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Stadtgeschichtliches Museum Weißensee. Archiv

Name:
Stadtgeschichtliches Museum Weißensee. Archiv

Kurzname:

Tr�gereinrichtung:
Bezirksamt Pankow von Berlin, Kulturamt Pankow

Strasse:
Prenzlauer Allee 227

Postleitzahl:
10405

Ort:
Berlin

Postanschrift:

Telefon:
(030) 42401270

Telefax:

E-Mail:

Homepage:

Leitung:
Frau Kuhlmann

Mitarbeiter(innen):
1

�ffnungszeiten:
Di 13.00-18.00

Verkehrsverbindung:
Senefelder Platz (U2); Tram 1

Best�nde:
Ca. 350 historische Postkarten, ca. 4 000 Fotografien, Zeitungsarchiv seit 1960, diverse Dokumente der Regionalgeschichte.

Findmittel:
Teilweise vorhanden, Postkarten EDV-erfasst.

Ver�ffentlichungen:

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Stiftung "Neue Synagoge Berlin - Centrum Judaicum". Archiv

Name:
Stiftung "Neue Synagoge Berlin - Centrum Judaicum". Archiv

Kurzname:

Tr�gereinrichtung:

Strasse:
Oranienburger Straße 28-30

Postleitzahl:
10117

Ort:
Berlin

Postanschrift:

Telefon:
(030) 88028425, 88028426

Telefax:
(030) 88028405

E-Mail:
archiv@cjudaicum.de

Homepage:
www.cjudaicum.de

Leitung:
Barbara Welker

Mitarbeiter(innen):
2

�ffnungszeiten:
Di-Do 10.00-16.00 (für auswärtige Benutzer auch Mo 10.00-16.00), Anmeldung und Terminabsprache unbedingt erforderlich

Verkehrsverbindung:
Oranienburger Straße (S 1, 2, 25); Hackescher Markt (S, Tram); Oranienburger Tor (U 6); S-Bhf. Oranienburger Straße (Tram 1, 6, 13)

Best�nde:
1. Bestände aus dem früheren Gesamtarchiv der deutschen Juden: Akten von 400 jüdischen Gemeinden aus dem gesamten Deutschen Reich (darunter fast keine Personenstandsregister!), von Gemeindeverbänden, Rabbinaten und Organisationen sowie Nachlässe und Sammlungen aus dem Zeitraum 17. Jh.-1945 (Schwerpunkt 19. Jh. bis 1. Drittel des 20. Jh.). 2. Verschiedene Unterlagen der Jüdischen Gemeinde zu Berlin vor 1945, darunter Austrittskartei der Gemeinde (Mikrofiche-Kopien der Beisetzungsregister des jüdischen Friedhofs in Berlin-Weißensee ab 1880), Akten und Registerbände des Jüdischen Krankenhauses Berlin (1888-1978); Akten der Jüdischen Gemeinde Halle/Saale (1859-1943, 1945-1995). 3. Personalakten jüdischer Zwangsarbeiter bei der Farbenfabrik "Warnecke & Böhm" in Berlin-Weißensee (Kopien) (1939-1943). 4. Kartei und Anträge auf eine Anerkennung als "Opfer des Faschismus"/"Opfer der Nürnberger Gesetzgebung" beim Magistrat der Stadt Berlin (1945-1948). 5. Akten der Jüdischen Gemeinde zu Berlin (1945-1990);
Akten des Verbandes der Jüdischen Gemeinden in der DDR (1945-1991). 6. Nachlässe und Personenfonds, u. a.: Manuskript von Gertrud Kolmar für den Gedichtzyklus "Das Wort der Stummen", 1933; Teilnachlass Moritz Becker (1830-1901) und Arthur Becker (1862-1933); Teilnachlass (Sammlung) Sigmund Feist (1865-1943) (Feldpostbriefe aus dem Ersten Weltkrieg); Nachlass Rabbiner Emil Bernhard Cohn (1881-1948). 7. Sammlungen (Familienpapiere, Erinnerungsberichte, Fotos, Druckschriften, Plakate usw.).
Eine detaillierte Übersicht über die Bestände mit z. T. vollständig publizierten Findbüchern wurde 2001 veröffentlicht (s. u.).

Findmittel:
Beständeübersicht, Findbücher, Karteien, Zugangslisten.

Ver�ffentlichungen:
Quellen zur Geschichte der Juden in den Archiven der neuen Bundesländer, hrsg. von Stefi Jersch-Wenzel und Reinhard Rürup, Bd. 6: Stiftung "Neue Synagoge Berlin - Centrum Judaicum" (2 Teile), bearb. von Barbara Welker unter Mitarbeit von Bernd Braun [...], München 2001; Barbara Welker: Das Archiv der Stiftung "Neue Synagoge Berlin - Centrum Judaicum", in: Menora. Jahrbuch für deutsch-jüdische Geschichte, Bd. 12 (2001), S. 325-343; Sabine Hank/Hermann Simon (Hrsg.): Feldpostbriefe jüdischer Soldaten 1914-1918, Teetz 2002.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Stiftung Deutsches Technikmuseum. Historisches Archiv

Name:
Stiftung Deutsches Technikmuseum. Historisches Archiv

Kurzname:

Tr�gereinrichtung:

Strasse:
Trebbiner Straße 9

Postleitzahl:
10963

Ort:
Berlin

Postanschrift:

Telefon:
(030) 90254133

Telefax:
(030) 90254175

E-Mail:
schmalfuss@dtmb.de

Homepage:
www.dtmb.de

Leitung:
Jörg Schmalfuß

Mitarbeiter(innen):
7

�ffnungszeiten:
Di-Do 10.00-17.15, Fr 10.00-14.00

Verkehrsverbindung:
Gleisdreieck (U1, 15, 2); Möckernbrücke (U1, 15, 7); Bus 129, 341

Best�nde:
Das Historische Archiv sichert und bewahrt archivalische Quellen zur Technik-, Wirtschafts- und Sozialgeschichte. Den Grundstock der übernommenen Materialien bildeten die Archive der Vorgängermuseen und Fördervereine des Deutschen Technikmuseums Berlin. Gegenwärtig umfasst der auf 7,5 Regalkilometer angewachsene Gesamtfundus über 75 Firmen- und Verbandsarchive aus Industrie, Handel und Gewerbe sowie mehr als 175 Nachlässe und Sammlungen von Persönlichkeiten aus dem Bereich der Natur- und Ingenieurwissenschaften, der Technik und des Verkehrs.
Ergänzt werden die Bestände durch umfangreiche Sondersammlungen zu den Gruppen Firmenschriften (50 000), Reiseprospekte (10 000), Fahrkarten (120 000), Zahlungsmittel und Medaillen (2 500), Siegel und Werbemarken (5 200) sowie Postkarten (20 000). Die Plansammlung umfasst 5 000 technische Zeichnungen zum Maschinen- und Ingenieurbau sowie 30 000 Land- und Seekarten. Zur Bildersammlung gehört neben zahlreichen Gemälden, Graphiken und Drucken eine bedeutende Sammlung früher Fahrrad- und Luftfahrtplakate.
Das Bildarchiv verwaltet über eine Million Aufnahmen zu allen Themen der Technik und des Verkehrs. Besondere Schwerpunkte bilden die Bereiche Industrie-, Design- und Architekturfotografie sowie die Nachlässe bekannter Bildjournalisten.
Vorgängermuseen und Fördervereine: Deutsche Luftfahrtsammlung e.V., Förderverein des Museums für Verkehr und Technik, Gesellschaft zur Wiedereinrichtung eines Verkehrsmuseums in Berlin, Museum und Institut für Meereskunde, Verkehrs- und Baumuseum.
Verbandsarchive: Berliner Verband Technisch-Wissenschaftlicher Vereine, Buchbinderinnung Berlin, Deutscher Betonverein, Graveur- und Ziseleurinnung Berlin.
Firmenarchive: Borsig GmbH, AEG-Telefunken AG, Anhaltische Buchdruckerei Gutenberg, Berliner Maschinenbau AG vorm. L. Schwartzkopff, Berliner Vergaser- und Filterwerke, Berthold AG, Bronzegießerei S. A. Loevy, Buchdruckerei Kroll & Straus, Carl Leiss und Rudolf Fuess, Deutsche Werke Spandau, Eisenwerk Franz Weeren, Elektrotechnische und Bogenlampenfabrik Kurt Weinert, Filmgesellschaft Nar & Polley, Deutsche Nyanza Schiffahrts GmbH, Posamentenfabrik Friedrich Greifenhagen, Steffens & Noelle, Schmidt & Haensch Optisch-Mechanische Werkstätten, Fritz Werner & Niles Werkzeugmaschinen AG, Kinotechnische Werkstätten Walter Knetsch, Podzun-Pallas-Verlag, Maschinenfabrik Carl Hoppe, Meierei C. Bolle, Notenstecherei Rudolf Paris, Pneumant Reifenwerke, RAW Warschauer Straße, Reederei Halle, Rixe & Co. GmbH, Markt- und Kühlhallengesellschaft, VE Kombinat Deutrans, Schiffs- und Yachtbauwerft Arthur Neesen, Teltowkanal AG, Vordruck-Leitverlag Berlin, Wagenfabrik Johann Kolbe, Zündapp-Werke GmbH.
Nachlässe und Sammlungen: Piet Ariel, Arthur Christiani, Fritz Bauer, Alexander Baumann, Oskar Dahlke, Theodor Düring, Ernst Eberstein, Heinz Erblich, Fritz Ewald, Wolfgang Federmann, Feißl, Franz Maria Feldhaus, Waldemar Geest, Heinz Geiseler, Adolph Giesl-Gieslingen, Gerhart Goebel, Martin Haller, Heinrich Herzberg, Wolf Hirth, Erich Hoffmann, Rudolf Hoffmann, Hermann Honnef, Waldemar Ilberg, Richard Jahre, Nikolaus Kelen, Günter Kloss, Friedrich Kittlaus, Walter Kober, Georg Krupp, Richard Lehnert, Robert von Lieben, Paul und Gerti Lieberenz, Gustav Lilienthal/Halle, Alfred Loewe, Fritz Loose, Georg Lotter, Kurt Malz, Gaston Adelin Mathieu, Bernd Maywald, Ernst Meineke, C. Ph. Melms, Günter Hermann Metzeltin, Franz zur Nedden, Fritz Neubecker, Carl Neubronner, Friedrich Neuhaus, Gerhard Nitschke, Neal W. O'Connor, Erich Offermann, Paul Pausinger, Kurt Pierson, Bruno Poelke, Ernst Randzio, Richard Roosen, Wilhelm Sachsenberg, Gerhard Sarodnik, Schadow, Hans Schaller, Kurt Schnauffer, Günther Schneggenburger, Arthur Schreiber, Peter Heinrich Schreurs, Ulrich Schwanck, Werner Schwipps, Hans Seehase, Werner Sell, Alfred Siebert, Wilhelm Siegert, Willy Stiasny, Wolfgang Stoff, Karl Theis, Karl August Tramm, Fritz Trenkle, Werner Treibel, Werner Usbeck, Max Volmer, Wolf Dietrich Wagner, Gerhard Weiler, Kurt Wenzelburger, Günther Wiens, Günter Winkler, Walter Zimmermann, Hugo Zorn.
Bibliothek: Präsenzbibliothek mit ca. 400 000 Bänden.

Findmittel:
Datenbanken, Findbücher, Karteien.

Ver�ffentlichungen:
Jörg Schmalfuß: Das Museum für Verkehr und Technik und sein Archiv, in: Archiv und Wirtschaft 3, 1993; Aufgetaucht. Das Museum und Institut für Meereskunde im Museum für Verkehr und Technik, Berlin 1996; Jörg Schmalfuß: Das Unternehmensarchiv und die Produktsammlung der AEG im Deutschen Technikmuseum Berlin, in: Archiv und Wirtschaft 3, 1999; Lieselotte Kugler: Die AEG im Bild, Berlin 2000.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Stiftung Preußische Schlösser und Gärten Berlin-Brandenburg. KPM-Archiv (Land Berlin)

Name:
Stiftung Preußische Schlösser und Gärten Berlin-Brandenburg. KPM-Archiv (Land Berlin)

Kurzname:

Tr�gereinrichtung:

Strasse:
Schloss Charlottenburg, Luisenplatz

Postleitzahl:
14059

Ort:
Berlin

Postanschrift:
Schlösserdirektion, Postfach 601462, 14414 Potsdam

Telefon:
(030) 32091416; (0331) 9694146

Telefax:
(030) 32091401

E-Mail:
s.wittwer@spsg.de

Homepage:

Leitung:
Dr. Samuel Wittwer

Mitarbeiter(innen):
1

�ffnungszeiten:
nach Vereinbarung

Verkehrsverbindung:
Sophie-Charlotte-Platz (U2); Bus 145

Best�nde:
Nach jahrzehntelanger kriegsbedingter Irrfahrt gelangte 1981 das zuletzt im Märkischen Museum gelagerte historische Archiv im Austausch gegen die Schlossbrückenfiguren in den Westteil der Stadt in das Schloss Charlottenburg. Ein bereits 1961 von den ehemaligen DDR-Behörden zurückgegebener Teilbestand wurde zwischen der Manufaktur und dem Kunstgewerbemuseum PK aufgeteilt, 1984 jedoch wieder dem Gesamtbestand beigegeben. 1. Archivalien: 393 Akten überwiegend 19. Jh., endend mit dem Jahr 1903; 2. Vorlagen: Eigene Entwürfe (Originale) der Maler (9 300 Stück), Reproduktionen (47 754 Stück): Radierungen (16.-18. Jh.), Aquarelle (19.-20. Jh.), Lithographien, Stahlstiche, Fotos (ca. 7 000 Stück), Buchdruck (ca. 11 000 Blätter); 190 Ölskizzen und -studien; 3. Gemälde: 140 Stück (19. Jh.), darunter 78 Ansichten aus Berlin, Potsdam, den Rheinlanden und Schlesien von Carl Daniel Freydanck. Bibliothek: ca. 2 500 Bde.

Findmittel:
Z. Zt. nur Aktenverzeichnis.

Ver�ffentlichungen:
Ilse Baer: Das Historische Archiv der Staatlichen Porzellan-Manufaktur seit seiner Rückgabe durch die DDR (1981), in: Dahlemer Archivgespräche, hrsg. von Eckart Henning, 7 (2001), S. 167-184.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Stiftung Stadtmuseum Berlin. Alexander von Humboldt-Sammlung

Name:
Stiftung Stadtmuseum Berlin. Alexander von Humboldt-Sammlung

Kurzname:

Tr�gereinrichtung:

Strasse:
Poststraße 13-14

Postleitzahl:
10178

Ort:
Berlin

Postanschrift:

Telefon:
(030) 24002221

Telefax:
(030) 24002187

E-Mail:
veigel.h@stadtmuseum.de

Homepage:

Leitung:
Dr. Hans-Joachim Veigel

Mitarbeiter(innen):

�ffnungszeiten:
nach Voranmeldung allgemein zugänglich

Verkehrsverbindung:
Alexanderplatz (S, U); Klosterstraße (U 2); Bus 100, 147, 148, 257

Best�nde:
Druckwerke, Autographen, Graphik, Medaillen, Plastik, Zeitungsausschnitte und Separatdrucke von Alexander von Humboldt und seinem Umfeld.

Findmittel:
Katalog.

Ver�ffentlichungen:
Alexander von Humboldt - Forschungsreisender und Kosmopolit (Ausstellung in Berlin und Bonn), Katalog 1999.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Stiftung Stadtmuseum Berlin. Bilderbogensammlung

Name:
Stiftung Stadtmuseum Berlin. Bilderbogensammlung

Kurzname:

Tr�gereinrichtung:

Strasse:
Brüderstraße 10

Postleitzahl:
10178

Ort:
Berlin

Postanschrift:
Generaldirektion, Poststraße 13-14, 10178 Berlin

Telefon:
(030) 206132913

Telefax:
(030) 206132919

E-Mail:

Homepage:

Leitung:
Marlies Ebert

Mitarbeiter(innen):

�ffnungszeiten:
nach Voranmeldung Di und Do 10.00-16.00

Verkehrsverbindung:
Spittelmarkt (U2); Bus 147, 148, 257

Best�nde:
Die Sammlung von Bilderbogen im Stadtmuseum umfasst rund 4 000 Bilderbogen und Guckkastenbilder aus dem Ende des 18. Jahrhunderts bis zum 2. Weltkrieg, wobei der größte Teil aus dem 19. Jahrhundert stammt. Dabei sind Blätter aus fast allen deutschen Städten vertreten, die im 19. Jahrhundert durch eine Bilderbogenproduktion bekannt wurden. Einen besonderen Schwerpunkt bilden Bogen aus Neuruppin (Gustav Kühn und Oehmigke & Riemschneider) sowie aus Berlin (Winckelmann & Söhne). Als Vorläufer der illustrierten Zeitschriften widerspiegeln die Bilderbogen das tägliche Leben in Stadt und Land, aktuelle Ereignisse im In- und Ausland sowie preußische Militär- und Herrschaftsgeschichte. Ein anderer großer Teil der Sammlung beherbergt Mal-, Tusch-, Ausschneide-, Papiertheater- und Spielebogen für Kinder. Eine breite Fächerung der Inhalte bietet für die verschiedensten historischen Bereiche gleichermaßen interessantes Studienmaterial.

Findmittel:
Kataloge, Datenbank

Ver�ffentlichungen:
Die große Welt in kleinen Bildern; Berliner Bilderbogen aus zwei Jahrhunderten. Ein Katalog zur Sonderausstellung im Märkischen Museum vom 18. März bis 4. Juli 1999, Stadtmuseum Berlin, 1999; MuseumsJournal, Nr. I 1999, S. 84-85.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Stiftung Stadtmuseum Berlin. Domäne Dahlem

Name:
Stiftung Stadtmuseum Berlin. Domäne Dahlem

Kurzname:

Tr�gereinrichtung:

Strasse:
Königin-Luise-Str. 49

Postleitzahl:
14195

Ort:
Berlin

Postanschrift:

Telefon:
(030) 6663000

Telefax:
(030) 8316382

E-Mail:
kontakt@domaene-dahlem.de

Homepage:
www.domaene-dahlem.de

Leitung:
Dr. Peter Lummel, Dr. Joachim Mähnert

Mitarbeiter(innen):

�ffnungszeiten:
Benutzung des Archivs nach Voranmeldung

Verkehrsverbindung:
Dahlem-Dorf (U1); Bus 110, 183, X11, X83

Best�nde:
Unterlagen zur Geschichte der Domäne, zur Agrargeschichte Berlins und Brandenburgs einschließlich der DDR-Zeit; Prospekte zur Landtechnik und zu Landmaschinen; Nachlässe Hans Haase (Agrarjournalist) mit 20 000 Fotografien aus der Landwirtschaft zwischen 1945 und 1975 sowie Heinrich Ruths (Direktor der Berliner Stadtgüter).

Findmittel:

Ver�ffentlichungen:
Peter Lummel (Hrsg.): Vom Berliner Stadtgut zum Freilichtmuseum. Geschichte und Geschichten der Domäne Dahlem, Dahlemer Materialien V, Berlin 1997; ders.: Kaffee - vom Schmuggelgut zum Lifestyle-Klassiker. Drei Jahrhunderte Berliner Kaffeekultur, Berlin 2002.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Stiftung Stadtmuseum Berlin. Fotografische Sammlung

Name:
Stiftung Stadtmuseum Berlin. Fotografische Sammlung

Kurzname:

Tr�gereinrichtung:

Strasse:
Brüderstraße 10

Postleitzahl:
10178

Ort:
Berlin

Postanschrift:
Poststraße 13-14, 10178 Berlin

Telefon:
(030) 206132919, 206132920

Telefax:
(030) 206132919

E-Mail:
hahn.i@stadtmuseum.de, griebner@stadtmuseum.de

Homepage:

Leitung:
Ines Hahn

Mitarbeiter(innen):
1

�ffnungszeiten:
nach Voranmeldung Di und Do 10.00-16.00

Verkehrsverbindung:
Spittelmarkt (U2); Bus 147, 148, 257

Best�nde:
Der Grundstock der Sammlung entstand seit der Gründung des Märkischen Provinzalmuseums 1874. Sie verfügt heute über die ältesten fotografischen Bestände innerhalb des Stadtmuseums und zum Teil innerhalb Berlins. Die frühesten Belege befinden sich in der Sammlung der Daguerreotypien mit Personendarstellungen seit den 1840er Jahren und in der Sammlung der Stadtbildaufnahmen mit Papierabzügen seit den 1850er Jahren. Seit 1886, mit der Gewährung eines Etats durch die Berliner Stadtverwaltung, konnten Fotografen wie F. Albert Schwartz, Hermann Rückwardt und Georg Bartels gezielt mit Aufnahmen des sich verändernden Stadtbildes beauftragt wurden. Ziel des Sammelns war zunächst die Dokumentation historischer Bausubstanz, später kamen Aufnahmen markanter Neubauten, Personendarstellungen sowie Fotografien zum Zeitgeschehen und dem Berliner Alltag hinzu. Die Sammlung umfaßt Werke professioneller Architekturfotografen und Bildjournalisten ebenso wie Beispiele der Amateurfotografie und Familienalben. Den Schwerpunkt der Sammlung bildet der historische Bestand der Stadtbildfotografien von 1880 bis 1914. Die Bemühungen um die Berliner Stadtfotografie setzen sich mit Arbeiten von André Kirchner, Karl-Ludwig Lange, Jürgen Nagel, Helga Paris, Florian Profitlich, Gundula Schulze und Ulrich Wüst bis in die Gegenwart fort. Der Gesamtbestand umfaßt heute zirka 215.000 Positive und Negative.

Findmittel:
Kataloge, Datenbank im Aufbau

Ver�ffentlichungen:
Das Berlin der Jahrhundertwende. Georg Bartels - Photographien aus den Jahren 1886 bis 1907, Berlin 1990; Berlin zwischen Residenz und Metropole. Photographien von Herrmann Rückwardt 1871-1916, Berlin 1994; Hela Zettler und Horst Mauter, Berlin in frühen Photographien 1844-1900, Berlin 1994; StadtBlicke. Aus der Fotografischen Sammlung des Stadtmuseums Berlin, (Ausstellungskatalog) Berlin 2001.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Stiftung Stadtmuseum Berlin. Hausarchiv

Name:
Stiftung Stadtmuseum Berlin. Hausarchiv

Kurzname:

Tr�gereinrichtung:
Stiftung Stadtmuseum Berlin - Landesmuseum für Kultur und Geschichte Berlins

Strasse:
Poststraße 13-14

Postleitzahl:
10178

Ort:
Berlin

Postanschrift:

Telefon:
(030) 24002138

Telefax:
(030) 24002218

E-Mail:
jahn@stadtmuseum.de

Homepage:
www.stadtmuseum.de

Leitung:
Andrea Jahn

Mitarbeiter(innen):

�ffnungszeiten:
nach Voranmeldung allgemein zugänglich

Verkehrsverbindung:
Alexanderplatz (S, U); Klosterstraße (U 2); Bus 100, 147, 148, 257

Best�nde:
Seit Gründung des Märkischen Museums 1874 und des Berlin Museums 1962 sowie in der aus beiden Einrichtungen gegründeten Stiftung Stadtmuseum Berlin (ab 1995) wurden Schriftwechsel, Neuerwerbunterlagen, Bestandsnachweise, Ausstellungsunterlagen, und andere wichtige Verwaltungsakten aufbewahrt. Teil-Nachlaß des ehemaligen Direktors Walter Stengel.

Findmittel:
Findbuch

Ver�ffentlichungen:
Marlies Ebert, Hela Zettler: 120 Jahre Märkisches Museum. Streiflichter von der Gründung 1874 bis zum Museumsneubau 1908. Faltblatt zur Sonderausstellung im Märkischen Museum, Berlin 1994; Kai Michel: Die Geschichte des Märkischen Provinzial-Museums. In: Jahrbuch Stiftung Stadtmuseum Berlin 1996, Bd. 2, S. 180-195; Kurt Winkler: Walter Stengel (1882-1960) - Eine biographische Skizze. In: Jahrbuch Stiftung Stadtmuseum Berlin 1997, Bd. 3, S. 186-210.
Zur Geschichte des Hauses: Jahrbücher des Märkischen Museums; Kataloge über Neuerwerbungen des Berlin Museums; Faltblätter; Jahrbücher der Stiftung Stadtmuseum Berlin, Ausstellungskataloge des Märkischen Museums, des Berlin Museums und der Stiftung Stadtmuseum.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Stiftung Stadtmuseum Berlin. Landesmuseum für Kultur und Geschichte Berlins

Name:
Stiftung Stadtmuseum Berlin. Landesmuseum für Kultur und Geschichte Berlins

Kurzname:

Tr�gereinrichtung:

Strasse:
Poststraße 13-14

Postleitzahl:
10178

Ort:
Berlin

Postanschrift:

Telefon:
(030) 24002150

Telefax:
(030) 24002187

E-Mail:
generaldirektor@stadtmuseum.de

Homepage:
www.stadtmuseum.de

Leitung:
Generaldirektor: Dr. Kurt Winkler

Mitarbeiter(innen):

�ffnungszeiten:
Sammlungen nach Voranmeldung allgemein zugänglich

Verkehrsverbindung:
Alexanderplatz (S, U); Klosterstraße (U 2); Bus 100, 147, 148, 257

Best�nde:
Siehe unter den einzelnen Sammlungen der Stiftung Stadtmuseum.

Findmittel:
Findbücher, Karteien, Kataloge, Datenbanken (teilweise im Aufbau).

Ver�ffentlichungen:
Jahrbuch Stiftung Stadtmuseum Berlin 1995 ff., Bd. 1 ff., hrsg. vom Generaldirektor des Stadtmuseums Berlin Reiner Güntzer, Berlin 1997 ff.; Kai Michel: Die Geschichte des Märkischen Provinzial-Museums, in: Jahrbuch Stiftung Stadtmuseum Berlin 1996, Bd. 2, Berlin 1998, S. 180-195; Kurt Winkler: Walter Stengel (1882-1960) - Eine biographische Skizze, in: Jahrbuch Stiftung Stadtmuseum Berlin 1997, Bd. 3, Berlin 1999, S. 186-210; Marlies Ebert: Erinnerungen an Hermann Duncker - Stadtrat, Syndikus, Bürgermeister Berlins, in: Jahrbuch Stiftung Stadtmuseum Berlin 1996, Bd. 2, S. 112-131; Alexander von Humboldt. Forschungsreisender und Kosmopolit (Ausstellung in Berlin und Bonn), Katalog 1999; Hela Zettler/Horst Mauter: Berlin in frühen Photographien 1844-1900, Berlin 1994; "Suche Nägel, biete gutes Theater". Theater in Berlin nach 1945, Teil I, Berlin 2001; "Daß die Musik nicht ohne Wahrheit leben kann". Theater in Berlin nach 1945, Teil II, Berlin 2001; Dorit Lücke: Archivalische Schätze des Modeinstitutes der DDR, in: "Berliner Chic" (Ausstellungskatalog 2001); Peter Lummel (Hrsg.): Kaffee - vom Schmuggelgut zum Lifestyle-Klassiker. Drei Jahrhunderte Berliner Kaffeekultur, Berlin 2002; Sportmuseum Berlin (Hrsg.): Sportstadt Berlin in Geschichte und Gegenwart. Jahrbuch 1993 des Sportmuseums Berlin, Berlin 1993.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Stiftung Stadtmuseum Berlin. Modearchiv - Poelzig-Halle

Name:
Stiftung Stadtmuseum Berlin. Modearchiv - Poelzig-Halle

Kurzname:

Tr�gereinrichtung:

Strasse:
Hugo-Cassirer-Str. 40-44/Eingang Poelzigstr.

Postleitzahl:
13587

Ort:
Berlin

Postanschrift:
Generaldirektion, Poststraße 13-14, 10178 Berlin

Telefon:
(030) 35305963

Telefax:
(030) 35305975

E-Mail:

Homepage:

Leitung:
Dorit Lücke

Mitarbeiter(innen):

�ffnungszeiten:
nach Voranmeldung allgemein zugänglich

Verkehrsverbindung:
Haselhorst (U7); Bus 131

Best�nde:
Dokumente über 40 Jahre Textil- und Bekleidungsindustrie der DDR; Archivalien zur Geschichte des Modeinstitutes; Entwürfe, Fotos, Dias, Plakate, Zeitungsausschnitte, wissenschaftliche Abschlussarbeiten, Bücher, Zeitschriften.

Findmittel:
Kataloge, Datenbanken.

Ver�ffentlichungen:
Dorit Lücke: Archivalische Schätze des Modeinstitutes der DDR, in: "Berliner Chic" (Ausstellungskatalog 2001).

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Stiftung Stadtmuseum Berlin. Naturwissenschaftliche Sammlungen

Name:
Stiftung Stadtmuseum Berlin. Naturwissenschaftliche Sammlungen

Kurzname:

Tr�gereinrichtung:

Strasse:
Schlossstr. 69 A

Postleitzahl:
14059

Ort:
Berlin

Postanschrift:
Generaldirektion, Poststraße 13-14, 10178 Berlin

Telefon:
(030) 3425030, 3426030

Telefax:
(030) 3424597

E-Mail:

Homepage:

Leitung:
Dr. Dietmar Andres

Mitarbeiter(innen):
4

�ffnungszeiten:
nach Voranmeldung allgemein zugänglich

Verkehrsverbindung:
Westend (S); Richard-Wagner-Platz (U7); Sophie-Charlotte-Platz (U12, 2); Bus X21, 109, 145, 210

Best�nde:
Materialien zur Biologie, Paläontologie, Geologie, wie z. B. Lehrtafeln, Wandkarten, Holzschnitte, Stiche, Drucke, Radierungen, Bild- und Fotomaterial; Spezielle Sammlungen: 1. Prof. Dr. Kurt Heinze (Experte für Viruskrankheiten der Pflanzen), Manuskripte, Handschriften, Fotos und Skizzen; 2. Alfred Schaefer (Hobbyforscher), entomologischer Nachlaß, Korrespondenz.

Findmittel:

Ver�ffentlichungen:

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Stiftung Stadtmuseum Berlin. Sammlung Berliner Werkzeugmaschinenfabrik

Name:
Stiftung Stadtmuseum Berlin. Sammlung Berliner Werkzeugmaschinenfabrik

Kurzname:

Tr�gereinrichtung:
Stiftung Stadtmuseum Berlin

Strasse:
Poststraße 13-14

Postleitzahl:
10178

Ort:
Berlin

Postanschrift:

Telefon:
(030) 24002166

Telefax:
(030) 24002189

E-Mail:
info@stadtmuseum.de

Homepage:
www.stadtmuseum.de

Leitung:
N.N.

Mitarbeiter(innen):
keine

�ffnungszeiten:
Benutzung nur nach Voranmeldung

Verkehrsverbindung:
Alexanderplatz (S, U); Klosterstraße (U2); Bus 100, 147, 148, 257

Best�nde:
Die Geschichte der Berliner Werkzeugmaschinenfabrik Marzahn geht auf die 1869 gegründete "G. Kärger-Fabrik für Werkzeugmaschinen A. G." in der Friedrichshainer Krautstraße zurück. Am 30. April 1945 wurde das Werk zerstört, die Demontage begann Pfingsten. Im selben Jahr wurde der Betrieb der Deutschen Treuhandverwaltung unterstellt. Er fertigte zunächst Steinputzmaschinen und Dachziegelpressen an, ferner Mechanikerdrehbänke für den Eigenbedarf. Von 1948 an hieß der Betrieb "Berliner Werkzeugmaschinenfabrik" (BWF).

1995 erfolgte die Übernahme der Materialien des umfangreichen Betriebsarchivs, dessen Schwerpunkt vor allem nach 1950 liegt, durch das Stadtmuseum Berlin. Es handelt sich um ca. 9 000 Fotografien (Negative und Postitive, nur z. T. in Farbe) von ca. 20 verschiedenen Bildautoren, Objekten der DDR-Arbeitswelt und Teile des ehemaligen Betriebsarchivs sowie die Video-Kopie des anderthalbstündigen Films "Ich bin Bürger der DDR" von Dr. Erika Runge und Michael Ballhaus (Kamera), der im Auftrag des WDR in diesem DDR-Vorzeigebetrieb gedreht und kurz darauf von der ARD gesendet wurde.

Findmittel:

Ver�ffentlichungen:
Tobias Böhm, Cornelia Böhnstedt: Vollbeschäftigt - halb versorgt. Bilder aus der Berliner Werkzeugmaschinenfabrik Marzahn, Begleitbuch zur Ausstellung 15. November 1996 bis 15. Juni 1997; Tobias Böhm: ddr.doc Reste aus der Berliner Werkzeugmaschinenfabrik Marzahn, in: Museums Journal, Nr. IV 1996, S. 88-89.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Stiftung Stadtmuseum Berlin. Sammlung Historische Dokumente

Name:
Stiftung Stadtmuseum Berlin. Sammlung Historische Dokumente

Kurzname:

Tr�gereinrichtung:

Strasse:
Brüderstraße 10

Postleitzahl:
10178

Ort:
Berlin

Postanschrift:
Poststr. 13/14, 10178 Berlin

Telefon:
(030) 206132913, (030) 206132922

Telefax:
(030) 206132919

E-Mail:
zur Zeit nicht vorhanden

Homepage:

Leitung:
Marlies Ebert

Mitarbeiter(innen):
2

�ffnungszeiten:
nach Voranmeldung Di und Do 10.00-16.00

Verkehrsverbindung:
Spittelmarkt (U 2); Bus 147, 148, 257

Best�nde:
Die Sammlung Historische Dokumente des Stadtmuseums Berlin ist zur Darstellung und Erforschung der Stadtgeschichte Berlins angelegt worden. Entstanden ist sie vor allem aus dem Eigentum von Privatpersonen in Form von Schenkung oder Kauf. Mit ihren Materialien aus der Zeit vom 13. Jahrhundert bis zur Gegenwart, gehört sie zu den großen Sammlungen der Einrichtung, deren Geschichte mit dem Aufbau des Märkischen Museums seit 1874 beginnt. Nach der Gründung der Stiftung Stadtmuseum Berlin 1995 wurde der Bestand durch die seit 1962 gesammelten Archivalien des Berlin-Museums bereichert.
Inhaltlich werden schriftliche und bildliche Quellen, vor allem auf den Informationsträgern Pergament und Papier basierende Handschriften und Druckerzeugnisse zur Alltags-, Kunst-, Kultur- und Wirtschaftsgeschichte, sowie zur politischen Entwicklung Berlins, gesammelt, aufbewahrt, erschlossen und ausgewertet. Zu den Raritäten der Sammlung, die ca. 30 Sachbereiche umfasst, zählen die ca. 400 ältesten Urkunden vom 13. Jahrhundert bis zum Jahre 1709/1713. Von der Mitte des 17. bis zu Beginn des 19. Jahrhunderts liegt ein wesentlicher Hauptschwerpunkt der Sammlung. Hier sind es vor allem Edikte, Reskripte und Kabinettsorders, Handwerksprivilegien etc., die von den Kurfürsten und Königen erlassen und teilweise eigenhändig unterzeichnet worden sind, darunter allein über 100 von Friedrich dem Großen signierte. Die zum Teil sehr prachtvollen Jubiläumsurkunden sowie die Sammlung von Autographen, unter denen Namen wie Fürst von Hardenberg, Leberecht von Blücher, Neidhardt von Gneisenau, Karl Graeb, Christian Daniel Rauch, Gottfried Schadow, Robert Koch, Heinrich Wilhelm Krausnick und Vertreter der Hohenzollern zu finden sind, gehören ebenso wie die Nachlässe des Tabakfabrikanten Ermeler, der Unternehmerdynastie Ravené, des „Eisenbahnkönigs“ Strousberg oder des „Säulenheiligen“ Ernst Litfaß zu den bedeutendsten Materialien der Sammlung.
Als museumsspezifische Sammlung hat sie die Hauptaufgabe für Ausstellungsvorhaben des Stadtmuseums, die untrennbar mit Forschungsarbeit und Publikationstätigkeit verbunden sind, präsent zu sein. Darüber hinaus werden Ausstellungsprojekte und andere öffentlichkeitswirksame Vorhaben, die über die Grenzen des eigenen Museums hinausgehen, mit Fachkompetenz betreut und u. a. Leihgaben zur Verfügung gestellt. Grundsätzlich ist die Sammlung mit ihrer Vielzahl von Primärquellen nach Anmeldung auch zur öffentlichen Nutzung für alle Interessierten an der Erforschung der Berlingeschichte, wie zur allgemeinen regionalgeschichtlichen Forschung zur Mark Brandenburg, wie auch zu familiengeschichtlichen Forschungen, einsehbar.
Zum heutigen Zeitpunkt stehen unseren Besuchern für Recherchen ca. 50.000 Datensätze mit Autographen, Meister- und Gesellenbriefen, Edikten, Flugblättern, Bilderbogen, Ansichtskarten, historischen Zeitungsausschnitten usw. in einer Access-Datenbank zur Verfügung. Hinzu kommen Bestandsverzeichnisse, wie zu Beispiel den Handschriften Friedrichs II., den Nachlässen von Ernst Litfaß, der Familien Strousberg, Ermeler und Ravené, sowie des Malers und Schriftstellers Hanns Fechner.

Findmittel:
Kataloge, Access-Datenbank

Ver�ffentlichungen:
Marlies Ebert: Familienpapiere des "Eisenbahnkönigs" Bethel Henry Strousberg. Zu einer Neuerwerbung, in: Museums Journal. Berichte aus den Museen, Schlösser und Sammlungen in Berlin und Potsdam, Heft 4/1998, S. 97-98; Erwerbungen der Stiftung Stadtmuseum 1995–2000, in Jahrbuch Stiftung Stadtmuseum Berlin, 2000, S. 222, 226-231, 294, 300-307, 312; Marlies Ebert: ”Der Kaiser war fast immer dabei”, Postkarten zum Krönungsjubiläum, in: Berlinische Monatsschrift, Jg. 10, H 1, 2001, S. 13-17; Marlies Ebert: Die Geschichte der Familie und Tabakfirma Ermeler, in: Jahrbuch Stiftung Stadtmuseum Berlin, 2002, S.105-142.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Stiftung Stadtmuseum Berlin. Sammlung Theater und documenta artistica

Name:
Stiftung Stadtmuseum Berlin. Sammlung Theater und documenta artistica

Kurzname:

Tr�gereinrichtung:

Strasse:
Besucheranschrift: Hans-Poelzig-Str. 20

Postleitzahl:
13587

Ort:
Berlin

Postanschrift:
Poststraße 13-14, 10178 Berlin

Telefon:
(030) 35305940

Telefax:
030 35305975

E-Mail:

Homepage:

Leitung:
Dr. Lothar Schirmer

Mitarbeiter(innen):
6

�ffnungszeiten:
nach Voranmeldung allgemein zugänglich

Verkehrsverbindung:
Haselhorst (U7); Bus 131, 139

Best�nde:
Die Theatersammlung mit den Sammlungen des früheren Berlin Museums und des früheren Märkischen Museums konzentriert sich auf die Entwicklung des Berliner Theaters vom 18. Jahrhundert bis zur Gegenwart. Sie enthält Bühnenbildentwürfe und Kostümfigurinen (Sondersammlungen Roman Weyl, Christine Stromberg, Eva Schwarz, George Grosz, Deutsche Staatsoper), Bühnenbildmodelle und Kostüme, Grund- und Aufrißzeichnungen von Theatergebäuden, Szenenfotos (Schwerpunkt Berliner Theatergeschehen nach 1945; Sammlung Harry Croner, Abraham Pisarek, Werner Borchmann, Ludwig Binder, Eva Kemlein, kranichphoto, Archiv der ehemaligen Staatlichen Schauspielbühnen, Archiv der Deutschen Staatsoper, Archiv des ehemaligen Metropol-Theaters), Porträtzeichnungen und Szenendarstellungen (Sammlung Ingeborg Voss, Sammlung Paul Gehring, Sammlung Dora Elisabeth von Steiger, Sammlung Otto Wiedemann), Plakate, Theaterzettel, Programmhefte, Kritiken und andere Dokumente.

Der Bereich Literaturgeschichte enthält u.a. die Handschriftensammlung der Romane von Theodor Fontane, den Nachlaß des Verlegers Eduard Hitzig, den Teilnachlaß von Julius Stinde, die rezeptionsgeschichtliche Sammlung zum Werk Gerhart Hauptmanns, weitere Brief-, Autographen und Werkfragmentsammlungen.

Der Bereich Musikgeschichte enthält Materialien und Dokumente zum Konzertleben der Berliner Orchester, Musikvereinigungen und Chöre des 19. und 20. Jahrhunderts, eine umfangreiche Tonträger-, Walzen- und Notensammlung sowie die umfangreiche Sammlung mechanischer Musikinstrumente.

Der Bereich documenta artistica enthält Dokumente und Objekte der verschiedenen artistischen Genres, des Zirkus, des Varietées, des Kabaretts und der Schaustellerei, Nachlässe bzw. Teilnachlässe von Sammlern und Organisationen, Fachzeitschriften und -bücher, Programmzettel, Plakate (Sammlung Friedländer), Fotos (Sammlung Richard Weigel), Bild- und Tonträger, Noten, Modelle, Kostüme und Requisiten.

Findmittel:
Verschiedene Kataloge und Datenbanken.

Ver�ffentlichungen:
Roman Weyl. Grenzgänger der Szene, Bestandskatalog, Berlin 1992; Theater Gezeichnet - Ingeborg Voss und Paul Gehring, Berlin 1997; Eva Kemlein, Ingeborg Pietzsch, Eva Kemlein. Ein Leben mit der Kamera, Berlin 1997; George Grosz. Zeichnungen für Buch und Bühne, Berlin 2001; "Suche Nägel, biete gutes Theater". Theater in Berlin nach 1945, Teil I, Berlin 2001; "Daß die Musik nicht ohne Wahrheit leben kann". Theater in Berlin nach 1945, Teil II, Berlin 2001; "Nun ist es Zeit, das Antlitz neu zu schaffen". Theater in Berlin nach 1945, Teil III, Berlin 2002; "Damit die Zeit nicht stehen bleibt". Theater in Berlin nach 1945, Teil IV, Berlin 2003.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Stiftung Stadtmuseum Berlin. Sammlung zur Museumsgeschichte der DDR

Name:
Stiftung Stadtmuseum Berlin. Sammlung zur Museumsgeschichte der DDR

Kurzname:

Tr�gereinrichtung:

Strasse:
Brüderstraße 10

Postleitzahl:
10178

Ort:
Berlin

Postanschrift:
Generaldirektion, Poststraße 13-14, 10178 Berlin

Telefon:
(030) 206132940

Telefax:
(030) 206132919

E-Mail:
hecker@stadtmuseum.de

Homepage:

Leitung:
Uwe Hecker

Mitarbeiter(innen):

�ffnungszeiten:
nach Voranmeldung Di und Do 10.00-16.00

Verkehrsverbindung:
Spittelmarkt (U2); Bus 147, 148, 257

Best�nde:
Aktenbestand der Fachstelle für Heimatmuseen, des Instituts für Museumswesen, des Rates für Museumswesen und des ICOM Nationalkomitee 1953-1995; Fachschulabschlußarbeiten der Fachschulen für Museologen Leipzig 1958-1991und für Präparatoren Berlin; Kulturstatistik der Museen der DDR (Stammdaten) 1971-1990.

Findmittel:
Datenbank

Ver�ffentlichungen:

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Stiftung Stadtmuseum Berlin. Sportmuseum Berlin

Name:
Stiftung Stadtmuseum Berlin. Sportmuseum Berlin

Kurzname:

Tr�gereinrichtung:

Strasse:
Deutsches Sportforum, Hanns-Braun-Straße

Postleitzahl:
14053

Ort:
Berlin

Postanschrift:

Telefon:
(030) 3058300

Telefax:
(030) 3058340

E-Mail:
Sportmuseum.Berlin@t-online.de

Homepage:

Leitung:
Martina Behrendt, Christa Liebscher

Mitarbeiter(innen):
4

�ffnungszeiten:
öffentlich zugänglich nur nach telefonischer Voranmeldung

Verkehrsverbindung:
Olympiastadion (S75, 9); Olympia-Stadion (U12, 2)

Best�nde:
Das Archiv beinhaltet Dokumente aller Art zur Geschichte von Turnen, Sport und Spiel in Berlin-Brandenburg. Darunter befinden sich ebenso umfangreiche Bestände von überregionaler Bedeutung, wie z.B. der gesamte schriftliche Nachlaß von Dr. J. Göhler (Mitbegründer des Deutschen Turner-Bundes und international renommierter Turnfunktionär), der Nachlaß des persönlichen Referenten des Reichssportführers von Tschammer und Osten und Direktor des Pädagogischen Institutes der Reichsakademie für Leibesübungen, Dr. H. Wetzel; Sammlungen zur Geschichte des Arbeitersports, das Archiv des DDR Sporthistorikers Dr. L. Skorning, die umfangreiche Sammlung/Statistiken zur Geschichte des Gehsports (1920-1970er Jahre) von W. Horlemann; Aktenbestände und Einzeldokumente zahlreicher DDR Sportverbände (80er Jahre 20. Jh.), das Archiv des Laufes 25 km de Berlin veranstaltet von den Französischen Streitkräften in Berlin, das komplette Archiv des Sportinformationsdienstes, Redaktion Berlin (1983-2000) sowie Sammlungen unterschiedlichen Charakters zur Geschichte der internationalen Laufsportbewegung, insbesondere der verschiedenen großen Stadtmarathone einschließlich des Berlin Marathon.

Findmittel:

Ver�ffentlichungen:
Sporthistorische Blätter, Heft 1-11; Sportmuseum Berlin (Hrsg.): Sport in Berlin. Kulturhistorische Schätze aus der Olympia-Stadt, Berlin 1991; Sportmuseum Berlin (Hrsg.): Sportstadt Berlin in Geschichte und Gegenwart. Jahrbuch des Sportmuseums Berlin, Berlin 1993.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Stiftung zur Aufarbeitung der SED-Diktatur

Name:
Stiftung zur Aufarbeitung der SED-Diktatur

Kurzname:

Tr�gereinrichtung:

Strasse:
Otto-Braun-Straße 70-72

Postleitzahl:
10178

Ort:
Berlin

Postanschrift:

Telefon:
(030) 23247200, 23247219, 23247216

Telefax:
(030) 23247210

E-Mail:
buero@stiftung-aufarbeitung.de, m.buchholz@stiftung-aufarbeitung.de bzw. s.griwan@stiftung-aufarbeitung.de

Homepage:
www.stiftung-aufarbeitung.de

Leitung:
Dr. Matthias Buchholz

Mitarbeiter(innen):
2

�ffnungszeiten:
nach Vereinbarung

Verkehrsverbindung:
Alexanderplatz (S, U2, 5, 8); Moll-/Otto-Braun-Straße (Bus 142, 257, 340, Tram)

Best�nde:
Archiv befindet sich im Aufbau. Vor-/Nachlässe im Kontext von Opposition und Repression in der DDR; Sammlung Prof. Franke (zum Doping im DDR-Sport); Depositum amnesty international; Überlieferung der Enquete-Kommission "Aufarbeitung von Geschichte und Folgen der SED-Diktatur in Deutschland" der 12. Wahlperiode des Deutschen Bundestages und der Enquete-Kommission "Überwindung der Folgen der SED-Diktatur im Prozess der deutschen Einheit" der 13. Wahlperiode des Deutschen Bundestages als Depositum; Fotosammlung zur innerdeutschen Grenze; bildkünstlerischer Nachlass Roger Loewigs (ab Ende 2004); Archiv unterdrückter Literatur in der DDR, gegründet von Ines Geipel und Joachim Walther (ab 2005).

Findmittel:
Findbuch; weitere Findmittel befinden sich in Bearbeitung.

Ver�ffentlichungen:

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Technische Fachhochschule Berlin. Historisches Archiv

Name:
Technische Fachhochschule Berlin. Historisches Archiv

Kurzname:

Tr�gereinrichtung:

Strasse:
Luxemburger Straße 20a

Postleitzahl:
13353

Ort:
Berlin

Postanschrift:

Telefon:
(030) 45042706

Telefax:

E-Mail:
c_la@hotmail.com (Privatadresse Christina Lammertz)

Homepage:

Leitung:
Prof. Heinrich Lohe, Christina Lammertz

Mitarbeiter(innen):
2

�ffnungszeiten:
Di, Do 11.00-14.00 und nach Vereinbarung

Verkehrsverbindung:
Amrumer Straße (U9); Leopoldplatz (U6, 9); Bus 221, 248

Best�nde:
Geschichte des Ingenieurwesens in Berlin über die Anfänge (Schinkelakademie) bis hin zur Fachhochschule mit Zeugnissen, Personalakten, Originalzeichnungen, Briefen, Fotos, Klassenbüchern etc.

Findmittel:
Das Archiv ist ein Freihandarchiv mit musealem Charakter. Es verfügt leider noch nicht über eine zentrale Datenbank, steht aber für Auskünfte jederzeit zur Verfügung.

Ver�ffentlichungen:

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Technische Universität Berlin. Universitätsbibliothek. Hochschularchiv

Name:
Technische Universität Berlin. Universitätsbibliothek. Hochschularchiv

Kurzname:

Tr�gereinrichtung:

Strasse:
Fasanenstr. 88

Postleitzahl:
10623

Ort:
Berlin

Postanschrift:

Telefon:
(030) 31423685

Telefax:
(030) 31427802

E-Mail:
hochschularchiv@ub.tu-berlin.de

Homepage:
www.ub.tu-berlin.de/Benutzerführer/Benutzungsstellen/Hochschularchiv/index.html

Leitung:
Dr. Claudia Bergemann, N.N.

Mitarbeiter(innen):

�ffnungszeiten:
nach Vereinbarung (allgemein zugänglich; Aktenbenutzung nur mit Genehmigung des Universtitätspräsidenten)

Verkehrsverbindung:
Ernst-Reuter-Platz (U12, 2); Zoologischer Garten (S, U12, 2, 9); Tiergarten (S); Bus X9, 145, 245

Best�nde:
a) Geschichte: Die Sammlungen der Technischen Hochschule Berlin-Charlottenburg - einschließlich des Hochschularchivs - wurden durch Kriegseinwirkungen im Jahre 1943 fast vollständig zerstört. Mit den praktischen Arbeiten zum Wiederaufbau des Hochschularchivs wurde während des Rektorats von Prof. Iwan N. Stranski 1953 begonnen. Seit 1962 ist das Hochschularchiv organisatorischer Bestandteil der Universitätsbibliothek und nimmt die Aufgabe wahr, durch die planmäßige Sammlung und Erschließung von gedruckten und ungedruckten Materialien aus dem Bereich der Universität und ihrer Vorgängeranstalten (Bauakademie, Gewerbeakademie, Bergakademie, Technische Hochschule) eine Auskunftsbasis für Studien zur Wissenschafts- und Forschungsgeschichte der eigenen Hochschule sowie zur Entwicklung des technisch-naturwissenschaftlichen Unterrichtswesens insgesamt zu schaffen. Aus dieser Aufgabenstellung, der formalen Beschaffenheit einzelner Quellengattungen und aus arbeitsökonomischen Gründen resultiert die Gliederung der Bestände und Sammlungen des Archivs.
b) Art der Bestände: Akten der Zentralen Universitätsverwaltung, der ehemaligen Fakultäten und der Einrichtungen der Universität. Akten aus der Zeit vor 1945 sind nur zu etwa einem Drittel erhalten. Nachlässe: Gesamt- und Teilnachlässe von z. Zt. 35 Angehörigen der TH/TU. Hochschulgeschichtliche Sammlung: Einzelstücke (einschließlich Film- und Tondokumente) vornehmlich aus dem Bereich der TH/TU seit 1879. Biographische Sammlung: Materialien und Sekundärliteratur über Angehörige des Lehrkörpers der TH/TU, der Bauakademie, der Gewerbeakademie sowie über Ehrendoktoren und Ehrensenatoren der TH/TU. Schriftensammlung: biographisch unselbständige Literatur der Angehörigen des Lehrkörpers. Sammlung hochschulrechtlicher Vorschriften: Satzungen, Statuten, Prüfungsordnungen u. a. Flugblattsammlung. Bildarchiv: Fotografisches Material (Aufnahmen von Gebäuden, Innenräumen, Personen, universitären Veranstaltungen u. a.). Pressearchiv: Zeitungsausschnitte. Personaldokumentation: Grundlage bilden die verschiedenen als Zettelkataloge geführten Personenregister, in denen Lebensdaten, akademische Grade und Titel, Werdegänge usw. von Angehörigen des Lehrkörpers festgehalten werden. Sie werden durch parallel geordnete bio-bibliographische Register ergänzt.

Findmittel:
Repertorien, Karteien.

Ver�ffentlichungen:
Hans-Georg Malz: Hochschularchiv (einschl. TU-Biographie), in: Technische Universität. Aus der Chronik der Universitätsbibliothek 1884-1984, Berlin 1985, S. 216-222; ders.: Hochschularchiv, in: Rechenschaftsbericht 1993-1996, Berlin 1997, S. 27; ders.: Ein Erbe der Bauakademie: Sammlungen und Bibliotheken, in: 1799-1999. Von der Bauakademie zur Technischen Universität Berlin. Geschichte und Zukunft, Berlin 2000, S. 104-113; Technische Universität Berlin, Universitätsbibliothek: Benutzerführer, 19. veränd. Aufl., Berlin 2001, S. 26 f.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Technische Universität Berlin. Universitätsbibliothek. Plansammlung

Name:
Technische Universität Berlin. Universitätsbibliothek. Plansammlung

Kurzname:

Tr�gereinrichtung:

Strasse:
Straße des 17. Juni 152 (Raum A-K 171)

Postleitzahl:
10963

Ort:
Berlin

Postanschrift:

Telefon:
(030) 31423116

Telefax:
(030) 31479492

E-Mail:
plansammlung@ub.tu-berlin.de

Homepage:
www.ub.tu-berlin.de/plansammlung

Leitung:
Dr. Hans-Dieter Nägelke

Mitarbeiter(innen):
9

�ffnungszeiten:
Mo-Do 13.00-16.00

Verkehrsverbindung:
Ernst-Reuter-Platz (U12, 2); Tiergarten (S)

Best�nde:
Gründung der Plansammlung 1885 als "Architektur-Museum der TH Charlottenburg", und zwar als unmittelbare Fortsetzung der damals ebenfalls in der TH aufbewahrten Bestände des Beuth-Schinkel-Museums. Seit 1932 unter der Bezeichnung "Architekturarchiv der Technischen Hochschule Berlin" im Verkehrs- und Baumuseum im Gebäude des stillgelegten Hamburger Bahnhofs in Berlin. Kriegsbedingte Auslagerung der wichtigsten Architektennachlässe (F. Adler, David u. Friedrich Gilly, Carl G. und Carl F. Langhans, L. Persius, L. Runge, J. H. Strack, A. F. Stüler u. a.) und Verlust der ausgelagerten Sammlungsteile sowie Teilverluste der im Verkehrs- und Baumuseum verbliebenen Bestände. Einbuße von ca. 50 Prozent des Zeichnungsbestandes, sämtlicher Modelle sowie fast aller Akten und Findmittel. 1946 Rückführung der Sammlung an die Technische Universität. Seit Beginn der 50er Jahre unter dem Namen "Plansammlung der Architekturfakultät" wieder regelmäßig der Öffentlichkeit zugänglich. Die bedeutendste Ergänzung der Bestände brachte die 1971 erfolgte Angliederung der Plansammlung an die Universitätsbibliothek mit sich, in deren Folge die Architekturzeichnungen der ehemaligen, 1953 von der TU erworbenen Bibliothek des Architekten-Vereins zu Berlin mit den fast vollständigen Sammlungen der "Monatskonkurrenzen" und der "Schinkelwettbewerbe" (die der Architekten-Verein seit 1827 bzw. 1852 unter seinen Mitgliedern durchgeführt hatte) an die Plansammlung übergingen. Ca. 70 000 Originalzeichnungen von Architekten, Gartengestaltern und Stadtplanern: 1. Zeichnerische Nachlässe: Studienarbeiten, Reiseskizzen, Ideal- und Ausführungsentwürfe seit 1800 (von Friedrich Adler, Erwin Barth, Erich Blunck, Karl v. Diebitsch, Ludwig Dihm, Felix Genzmer, Edgar Giesenberg, Martin Gropius, Werner Harting, Emil Hoffmann, Ludwig Hoffmann, Hermann Jansen, Eduard Knoblauch, Otto Kohtz, Ludwig und Emil Lange, Paul Lehmgrübner, Richard Lucae, Carl Lüdecke, Werner March, Alfred Messel, Hermann Mattern, Karl Wilhelm Ochs, August Orth, Hans Poelzig, Martin Punitzer, Ferdinand v. Quast, Julius Raschdorff, Emil Rüster, Heinrich Seeling, Oskar Sommer, Wilhelm und Gustav Stier, Heinrich Strack, August Stüler, Sanmicheli Wolkenstein u. a.). - 2. Konkurrenz-Entwürfe: Neben den Architekten-Nachlässen sind Einzelarbeiten von Architekten vorwiegend im Zusammenhang mit den großen Wettbewerben des 19./20. Jh.s vorhanden (Reichstagskonkurrenzen, Wettbewerbe zum Berliner Dom, zur Bebauung der Museumsinsel in Berlin, zum Zentralbahnhof in Frankfurt/M., zum Reichsgericht in Leipzig, Hochschulwettbewerbe an der TH Berlin, Monatskonkurrenzen, Schinkelwettbewerbe u. a.). - 3. Stiche, Lithografien, Drucke. - 4. Historische Fotografien. - 5. Manuskripte, Skizzenbücher, Akten.

Findmittel:
Verfasser- und Ortskatalog, Architektenverzeichnis im Internet unter: www.ub.tu-berlin.de/Abteilungen/AbtBibliotheken/Plansammlung/archtab_start.html

Ver�ffentlichungen:
Franz Jahn: Ferdinand v. Quast (Veröffentlichungen des Architekturarchivs der Technischen Hochschule), Berlin 1936; Charlottenburg und die Technische Hochschule. Ausstellungskatalog, bearb. von Helmut Geisert, Dieter Radicke, Ingrid Schade, Technische Universität Berlin, 1980; Erwin Barth: Gärten, Parks, Friedhöfe. Ausstellungskatalog, Technische Universität Berlin, 1980; Die Plansammlung, Neuerwerbungen 1975-1985. Ausstellung, zusammengestellt von Peter Benkert, Paul Dludzniewski, Dieter Radicke, Susanne Schulz, Michael Veit, in: Technische Universität Berlin. Aus der Chronik der Universitätsbibliothek 1884-1984, Berlin 1985; Entwürfe preußischer Architekten im Ausland. Ausstellungskatalog, hrsg. von Harold Hammer-Schenk, XXVIII. Internationaler Kongress für Kunstgeschichte, Berlin 1992; K. E.-O. Fritsch: Die Gründung eines Architekturmuseums an der Technischen Hochschule zu Berlin, in: Deutsche Bauzeitung 20, 1886; Eduard Dobbert, Alfred G. Meyer: Sammlungen Architekturmuseum, in: Chronik der Königlichen Technischen Hochschule zu Berlin, Berlin 1899; Ute Büchs: Die Plansammlung der TU Berlin oder Historische Architektur und Museum, in: Festschrift Ernst Heinrich, Berlin 1974; Goerd Peschken mit Ute Büchs: Sammlungen historisch wertvoller Bauzeichnungen in Berlin, in: Zweites Jahrbuch des Werkbund-Archivs, Gießen 1977; Georg Malz, Dieter Radicke: Vom Architekturmuseum zur Plansammlung, in: Technische Universität Berlin. Aus der Chronik der Universitätsbibliothek 1884-1984, Berlin 1985; Dieter Radicke: Il fondo Poelzig nella Plansammlung della Technische Universität di Berlino, in: CASABELLA Nr. 575, Dicembre 1990; Dieter Radicke: Die Plansammlung, das ehemalige Architekturmuseum, in: Sammlungen und Kunstdenkmäler der Technischen Universität Berlin, Berlin 1991; Johannes Cramer: Vom Historismus zur Moderne. Das Architekturmuseum an der Technischen Hochschule Charlottenburg, in: Die Hand des Architekten. Zeichnungen aus Berliner Architektursammlungen, Berlin 2002, S. 151-168.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Technische Universität Berlin. Zentrum für Antisemitismusforschung. Archiv

Name:
Technische Universität Berlin. Zentrum für Antisemitismusforschung. Archiv

Kurzname:

Tr�gereinrichtung:

Strasse:
Ernst-Reuter-Platz 7

Postleitzahl:
10587

Ort:
Berlin

Postanschrift:
Zentrum für Antisemitismusforschung, TU Berlin, Sekr. TEL 9-1, Ernst-Reuter-Platz 7, 10587 Berlin

Telefon:
(030) 31423080

Telefax:
(030) 31421136

E-Mail:
birgit@zfa.kgw.tu-berlin.de

Homepage:
http://zfa.kgw.tu-berlin.de/archiv.htm; www.tu-berlin.de/zfa

Leitung:
Birgit Müller

Mitarbeiter(innen):
1

�ffnungszeiten:
nach Vereinbarung

Verkehrsverbindung:
Ernst-Reuter-Platz (U2)

Best�nde:
Das Archiv des Zentrums für Antisemitismusforschung sammelt Dokumente aus den Gebieten Antisemitismus, Nationalsozialismus, Rassismus und Rechtsextremismus, aber auch aus angrenzenden Gebieten, etwa der deutsch-jüdischen Geschichte und der Exilgeschichte. Ein zentraler Bestand zur juristischen Aufarbeitung des Nationalsozialismus sind die Akten der Nürnberger Prozesse aus den Jahren 1945 bis 1948. Dazu zählen die Unterlagen aus dem Hauptkriegsverbrecherprozess vor dem Internationalen Militärtribunal gegen Göring, Heß, Ribbentrop und andere sowie aus den zwölf nachfolgenden US-Militärgerichtsprozessen. Die Akten gliedern sich in mehrere Dokumentenreihen, in denen sich Beweismaterial der Anklage findet, und in mehrere Gruppen von Verhandlungsakten, zu denen die stenographischen Protokolle und die Dokumentenbücher von Anklage und Verteidigung zählen.
Das Archiv verfügt über biographische Unterlagen zu rund 25 000 deutschsprachigen Emigranten, die nach 1933 Mitteleuropa verlassen mussten. Die Sammlung entstand aus einem Forschungsprojekt der Research Foundation for Jewish Immigration in New York und des Instituts für Zeitgeschichte in München, aus dem das Biographische Handbuch der deutschsprachigen Emigration hervorgegangen ist. Zu den Sammlungen autobiographischer Dokumente gehört auch ein Bestand rund 150 vorwiegend unveröffentlichter Manuskripte und Unterlagen, in denen sich Erfahrungen von Verfolgung und Flucht spiegeln, ebenso Tonbänder und Interviewabschriften aus verschiedenen Forschungsprojekten. Auf Mikrofilm liegen außerdem 127 biographische Manuskripte deutscher Juden aus der Houghton Library der Harvard-Universität vor. Sie waren 1940 bei einem Wettbewerb unter dem Motto: "My Life in Germany Before and After January 30, 1933" eingereicht worden. Seit 1990 befindet sich im Zentrum auch das Archiv der American Federation of Jews from Central Europe in New York. Die Emigranten-Organisation vertritt seit 1939 die Interessen der aus dem nationalsozialistischen Deutschland in die USA emigrierten Juden. Der Bestand enthält Sitzungsprotokolle von 1939 bis 1973, Korrespondenzen mit Organisationen und Behörden sowie Personalunterlagen.
Im Jahr 2000 konnte die "Sammlung Diamant" erworben werden, die auf ca. 50 m Akten vor allem umfangreiches Material zu jüdischen Friedhöfen in Deutschland und Friedhofsschändungen seit der Zeit der Weimarer Republik enthält, außerdem eine Dokumentensammlung zu im Novemberpogrom 1938 zerstörten Synagogen sowie eine bis in die fünfziger Jahre zurückgehende Zeitungsausschnittsammlung zu den Themen Antisemitismus, jüdisches Leben in Deutschland sowie Vergangenheitsbewältigung. Daneben enthält die Sammlung Diamant eine Dokumentation zur Chemnitzer Gestapo sowie diverse Jahrbücher und Mitteilungsblätter jüdischer Einrichtungen.
Die Sammlung "Testaments to the Holocaust" aus dem Archiv der Wiener Library in London steht auf 76 Mikrofilmrollen zur Verfügung. Sie enthält nationalsozialistisches Propagandamaterial wie Bildbände, Kalender, die antisemitische Enzyklopädie "Sigilla Veri", Publikationen der Hitlerjugend, Schul- und Liederbücher. Dazu kommen jüdische Augenzeugenberichte über die nationalsozialistische Verfolgung, von denen einige bereits in den Wochen und Monaten nach dem Novemberpogrom 1938 entstanden sind. Von der Wiener Library herausgegebene Periodika von 1934 bis 1965 ergänzen diesen Bestand ebenso wie Fotos zu jüdischem Leben in der Weimarer Republik und unter nationalsozialistischer Herrschaft.
Auf 196 Mikrofilmrollen zugänglich ist außerdem der gesamte "Displaced Persons-Germany"- und "Leo W. Schwarz Papers"-Bestand des YIVO-Institute for Jewish Research in New York. Dabei handelt es sich um eine zentrale Quelle zur Geschichte der jüdischen Displaced Persons und zur jüdischen Geschichte im Nachkriegsdeutschland. Sie wird ergänzt durch DP-Zeitungen und -Zeitschriften. Eine Reihe von Periodika steht auf Mikrofilm zur Verfügung. Dazu zählen antisemitische Organe, etwa die Alldeutschen Blätter, La Libre Parole, der Stürmer oder der Völkische Beobachter ebenso wie Periodika zur Abwehr des Antisemitismus, etwa die Abwehrblätter, die C.V.-Zeitung oder die Berichte der Alliance Israélite Universelle. Dazu kommen Periodika, in denen sich die Beziehungsgeschichte zwischen Juden und Nichtjuden spiegelt, wie jüdische Tageszeitungen und Gemeindeblätter. Einen Spezialbestand bilden die gesammelten Ausgaben 30 jiddischer Zeitungen aus dem Berlin der Weimarer Republik. Eine Presseausschnittsammlung dokumentiert seit 1983 in wachsender Dichte Entwicklung und Wahrnehmung von Antisemitismus, Rechtsextremismus, Minderheitenfragen und Umgang mit der nationalsozialistischen Vergangenheit. Derzeit werden neun deutsche Tages- und Wochenzeitungen ausgewertet. Stichworte in Sach-, Personen- und Ländergruppen ermöglichen ein schnelles Auffinden der gesuchten Artikel. Den Zugriff auf rund 1 500 Dokumentarfilme, Reportagen und Spielfilme zu forschungsrelevanten Themen bietet eine Videosammlung. Eine Sammlung rechtsextremer und antisemitischer Publikationen, Flugblätter, Aufkleber und anonymer Briefe vorwiegend der achtziger und neunziger Jahre gibt Einblick in die Entwicklungen der internationalen rechtsextremen Szene. Zu diesem Bereich zählt auch eine Sammlung zur öffentlichen Wahrnehmung einschlägiger Phänomene mit Material zu Ereignissen, Skandalen und Affären der achtziger und neunziger Jahre, die Themen wie Antisemitismus oder Bearbeitung des Nationalsozialismus berühren. Eine Zusammenstellung von Urteilsbegründungen aus Prozessen gegen Rechtsextremisten und Holocaustleugner vervollständigt diesen Bereich.
Ein umfangreicher Bestand von Zuschauerbriefen zur Erstausstrahlung der amerikanischen Fernsehserie "Holocaust" in der Bundesrepublik Deutschland in den achtziger Jahren und eine Zusammenstellung von antisemitischen Briefen an die Botschaft des Staates Israel in Deutschland sind seit kurzem im Archiv für Wissenschaftler zugänglich. Unter mehreren Nachlässen, die im Archiv zur Verfügung stehen, ragt derjenige des Richters Horst Göppinger heraus, Autor des Standardwerkes "Juristen jüdischer Abstammung im ´Dritten Reich´". Der Nachlass enthält biographisches Material zum Schicksal jüdischer Juristen unter dem Nationalsozialismus und im Exil, eine Sammlung einschlägiger Aufsätze, Rezensionen und Zeitungsausschnitte sowie Material zum Reichsfinanzhof.

Findmittel:
Findbücher zu Einzelbeständen.

Ver�ffentlichungen:

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Topographische Sammlung

Name:
Topographische Sammlung

Kurzname:

Tr�gereinrichtung:
Stiftung Stadtmuseum Berlin

Strasse:
Poststraße 13-14

Postleitzahl:
10178

Ort:
Berlin

Postanschrift:

Telefon:
(030) 24002146

Telefax:
(030) /24002187

E-Mail:
heinemann@stadtmuseum.de

Homepage:

Leitung:
Gerd Heinemann

Mitarbeiter(innen):

�ffnungszeiten:
nach Voranmeldung Mo-Fr 9.00-16.30

Verkehrsverbindung:
Alexanderplatz (S, U); Klosterstraße (U 2); Bus 100, 147, 148, 257

Best�nde:
Karten und Pläne von Berlin 1688 bis heute, besonders 19. Jahrhundert; Karten der Umgebung von Berlin 18. Jahrhundert bis heute; Detailkarten zu verschiedenen Berliner Gebieten besonders 18. und 19. Jahrhundert; 20 Globen (Erd- und Himmelsgloben aus dem 18., 19. und 20. Jahrhundert); mehrere Modelle der Stadt Berlin ca. 1250 bis 1750; Baumodelle einzelner Gebäude.

Findmittel:
Karteikarten

Ver�ffentlichungen:

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

ullstein bild

Name:
ullstein bild

Kurzname:

Tr�gereinrichtung:

Strasse:
Axel-Springer-Straße 65

Postleitzahl:
10888

Ort:
Berlin

Postanschrift:

Telefon:
(030) 259173609

Telefax:
(030) 259173896

E-Mail:
kontakt@ullsteinbild.de

Homepage:
www.ullsteinbild.de

Leitung:
Frank Frischmuth

Mitarbeiter(innen):
22

�ffnungszeiten:
Mo-Fr 9.00-18.00 (Besuche nur nach Voranmeldung)

Verkehrsverbindung:
Kochstraße (U6); Stadtmitte (U2); Bus 129

Best�nde:
ullstein bild ist eine zeitdokumentarische Universalagentur für Profinutzer aus der Medienbranche. 1900 als Archiv des Ullstein Verlag für Texte und Bilder entstanden, wurde es 1928 ein eigenständiges Bildarchiv und 1950 der Bilderdienst, der als Agentur Bildrechte an zahlreiche Kunden im In- und Ausland vergibt. Seit 1995 werden digitale Bilder über eine APIS-Datenbank angeboten, seit 2001 auch über das Internet. 445.000 Motive sind digitalisiert und einzeln verfügbar. Monatlich wächst die Datenbank um 5 000 neue Fotos.
Damit wird ullstein bild dem Anspruch einer aktuellen zeitdokumentarischen Universalagentur gerecht. Schwerpunkte des historischen Bestandes bilden das Archiv von Ernst und Otto Haeckel, welche die Entwicklung Berlins und Deutschlands vor dem 1. Weltkrieg fotografisch begleiteten. Mit Bildern bekannter Fotografen - wie Fritz Eschen, Paul Swiridoff, Jochen Blume, Horst Tappe, Waldemar Titzenthaler, Yva - besitzt ullstein bild einen foto- und zeithistorisch wichtigen Bildfundus.

Findmittel:

Ver�ffentlichungen:

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Universität der Künste. Universitätsarchiv

Name:
Universität der Künste. Universitätsarchiv

Kurzname:

Tr�gereinrichtung:

Strasse:
Einsteinufer 43-53

Postleitzahl:
10587

Ort:
Berlin

Postanschrift:
Postfach 120544, 10595 Berlin

Telefon:
(030) 31852309, 31852733

Telefax:
(030) 31852795

E-Mail:
archiv@udk-berlin.de

Homepage:
www.archiv.udk-berlin.de

Leitung:
Dr. Dietmar Schenk

Mitarbeiter(innen):
2 (sowie studentische Hilfskräfte und projektbezogene Mitarbeiter/innen)

�ffnungszeiten:
Mo, Di, Mi, Fr 9.00-16.00, Do 9.00-18.00

Verkehrsverbindung:
Ernst-Reuter-Platz (U12, 2); Bus 101, 245

Best�nde:
Schriftarchive (Behördenarchive) und Bildvorlagen-Sammlungen (Grafiken, Fotografien, weitere Bildmedien) der Vorgängerinstitutionen, in begrenztem Umfang auch originale Lehrer- und Schülerarbeiten; Nachlässe; zeitgeschichtliche Dokumentationen wie Zeitungsausschnitt- und Flugblattsammlungen; moderne Verwaltungsunterlagen. Die Bestände beziehen sich auf sämtliche an der Universität der Künste vertretenen Sparten: Bildende Kunst, Gestaltung (Architektur, Design, Kommunikation), Musik und Darstellende Kunst. Die Vorgängereinrichtungen gehen zum Teil auf die brandenburgisch-preußische Akademie der Künste (gegr. 1696) zurück. Sie gehörten in der Zeit der Teilung Berlins zum Westteil. Im Universitätsarchiv befinden sich die Archive sämtlicher Vorgängereinrichtungen sowie das Archiv der Fachschule für Werbung und Gestaltung, die in Berlin(-Ost) bestand.
Wichtige Archive von Vorgängerinstitutionen: Akademische Hochschule für die Bildenden Künste (gegr. 1875); Unterrichtsanstalt des Kunstgewerbemuseums (gegr. 1867); Vereinigte Staatsschulen für Freie und Angewandte Kunst (ab 1924); Kunstschule zu Berlin (gegr. 1869); Meisterschule für Graphik, Druck und Werbung (nach 1945); Meisterschule für das Kunsthandwerk (nach 1945); Akademische Hochschule für Musik (gegr. 1969); Institut für Kirchenmusik/Akademie für Kirchen- und Schulmusik (gegr. 1822); Staats- und Domchor (ab 1923, Überlieferung reicht weiter zurück); Stern'sches Konservatorium der Musik (gegr. 1850, nur Druckschriften); Konservatorium der Reichshauptstadt/Städtisches Konservatorium (ab 1936); Hebbel-Theater-Schule und Max-Reinhardt-Schule (nach 1945).
Wichtige Sammlungen: Ottomar Anschütz (Fotografien); Karl Blossfeldt (Fotografien, Kleinplastiken); Uli Huber (Gebrauchsgrafik); Kgl. Meßbild-Anstalt (Fotografien); Minutoli (Fotografien); Kgl. Institut für Glasmalerei (Fotografien).
Wichtige Nachlässe und Teilnachlässe: James Hobrecht (Architekt und Ingenieur); Joseph Joachim (Violinist); Gottfried Kühn (Gartenarchitekt); Max Rostal (Violinist); Karl Heinz Taubert (Tanzpädagoge).

Findmittel:
Findbücher und -listen, teils gedruckt, Datenbank. Eine Beständeübersicht in Form einer Broschüre wird 2003 erscheinen.

Ver�ffentlichungen:
Die Streichertradition der Hochschule für Musik (= UdK-Archiv 4), Berlin 2002; Pianisten in Berlin. Klavierspiel und Klavierausbildung seit dem 19. Jahrhundert (= UdK-Archiv 3), Berlin 1999; Dietmar Schenk: Karl Blossfeldt im Archiv der Berliner Hochschule der Künste, in: Konstruktionen von Natur. Von Blossfeldt zur Virtualität, hrsg. von der Akademie der Künste, Amsterdam, Dresden 2001, S. 115-139; ders.: Bildvorlagen-Sammlungen im Archiv der Berliner Universität der Künste, in: Jahrbuch für Universitätsgeschichte, Jg. 6 (2003), i. Vorb.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Verein für die Geschichte Berlins, Bibliothek und Archiv

Name:
Verein für die Geschichte Berlins, Bibliothek und Archiv

Kurzname:
VfdGB, Bibliothek und Archiv

Tr�gereinrichtung:

Strasse:
c/o ZLB Berlin Breite Straße 30-36

Postleitzahl:
10178

Ort:
Berlin

Postanschrift:
Verein für die Geschichte Berlins c/o ZLB Berlin Postfach 610179, 10922 oder Breite Str. 30-36, 10178 Berlin

Telefon:
(030) 90226444, 90226449

Telefax:

E-Mail:
bibliothek@diegeschichteberlins.de

Homepage:
www.diegeschichteberlins.de

Leitung:
Kollektiv

Mitarbeiter(innen):
4 (ehrenamtlich)

�ffnungszeiten:
Mi 15.00-18.45 Uhr, Zugang nur über Schloßplatz 7, 1. Hof, Eingang in der linken Ecke

Verkehrsverbindung:
Hausvogteiplatz (U2), Neumannsgasse (Bus 147), Lustgarten (Bus 100, 200), Fischerinsel (Bus M48, 248, 265)

Best�nde:
Bibliothek mit ca. 30.000 Bänden.
a) Geschichte: Der 1865 gegründete Verein hatte von 1875 bis 1943 seine Geschäftsstelle im Deutschen Dom und unterhielt dort eine Bibliothek und ein umfangreiches Archiv. Viele Unterlagen wurden durch den Bombenangriffe in 1943 und 1944 vernichtet, Teilbestände befinden sich heute im Besitz der Zentral- und Landesbibliothek Berlin und im Landesarchiv Berlin. Nach dem Kriege wurden Materialien zur Vereinsgeschichte von Mitgliedern zusammengetragen.
b) Art der Bestände: Unterlagen über die Vereinsgeschichte, Protokolle der Vorstandssitzungen und Mitgliederversammlungen, Fotosammlung von Vereinsmitgliedern im 19. Jahrhundert, Fotosammlung Mücke (Friedhöfe), Karten und Pläne (Originale und Nachdrucke).

Findmittel:
Kataloge, Repertorien.

Ver�ffentlichungen:
Berliner Chronik, hrsg. vom VfdGB durch Ernst Fidicin, Berlin 1868; Urkundenbuch zur Berlinischen Chronik, hrsg. von dem VfdGB, begonnen von Ferdinand Voigt, fortgesetzt durch Ernst Fidicin, Berlin 1880; Vermischte Schriften im Anschluss an die Berlinische Chronik, hrsg. vom VfdGB, Bd. 1 und 2, Berlin 1888; Schriften des Vereins für die Geschichte Berlins, H. 1-64, (1865-1989); Jahrbuch des Vereins für die Geschichte Berlins ab 1951 (ab 1954 unter dem Titel "Der Bär von Berlin"); Mitteilungen des Vereins für die Geschichte Berlins von 1884 bis 1943 und wieder ab 2976 (von 1934–1943 als Zeitschrift des Vereins für die Geschichte Berlins neben einem Nachrichtenblatt herausgegeben); Verzeichnisse der Mitglieder des Vereins; Fokus Berlin Mitte – 775 Jahre historischer Stadtkern, hrsg. vom VfdGB durch Wolther von Kieseritzky, Berlin 2012.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Werkbundarchiv - Museum der Dinge

Name:
Werkbundarchiv - Museum der Dinge

Kurzname:

Tr�gereinrichtung:

Strasse:
Oranienstraße 25

Postleitzahl:
10999

Ort:
Berlin

Postanschrift:

Telefon:
(030) 92106311

Telefax:
(030) 92106312

E-Mail:
info@museumderdinge.de

Homepage:
www.museumderdinge.de

Leitung:
Renate Flagmeier-Wesker, Imke Volkers

Mitarbeiter(innen):
2

�ffnungszeiten:
Archiv und Bibliothek sind von Montag bis Donnerstag 9-14 Uhr geöffnet. Bitte um vorherige Anmeldung das Museum ist von Freitag bis Montag 12-19 Uhr geöffnet.

Verkehrsverbindung:
U-Bahn: U1, U8 Kottbusser Tor; Bus: M29, 140 Adalbertstr./Oranienstr.

Best�nde:
Das Werkbundarchiv – Museum der Dinge ist ein Museum der von der industriellen Massen- und Warenproduktion geprägten Sachkultur des 20. Jahrhunderts. Kern der Institution ist das Archiv des Deutschen Werkbunds.

Die Dokumenten-Sammlung Deutscher Werkbund beinhaltet verschiedene Nachlässe und Teilnachlässe von Werkbund-Mitgliedern, Werkbund-Publikationen und sonstige Materialien. Sie rekonstruiert so facettenreich wie möglich die Organisationsgeschichte des Deutschen Werkbundes. Neben Originaldokumenten - Publikationen, Jahresberichten, Protokollen, Rundschreiben, Korrespondenzen und anderem - umfasst die Sammlung auch kopierte Fragmente von andernorts aufbewahrten Nachlässen und Archivbeständen, die wesentlichen Aufschluss über die Entwicklung des Werkbundes geben. Zeitlich umfassen die Bestände die Zeit vor der Gründung bis heute.

Das Museum beschränkt sich in seiner Sammlungs- und Ausstellungsarbeit jedoch nicht auf die Erzeugnisse von Werkbundkünstlern und -firmen, sondern bezieht den Wirkungsbereich des Werkbunds – den Alltag und die Waren produzierende Gesellschaft – in seine Arbeit ein. Die Sammlung umfasst ca. 35.000 Dokumente und ca. 20.000 Objekte, die überwiegend dem 20. Jahrhundert entstammen. Die Sammlung lebt aus den spannungsreichen Verhältnissen zwischen Werkbund-spezifischen Produkten und Massenware, kunstgewerblichen Einzelstücken und industriellen Erzeugnissen, Objekten namhafter Designer und dem anonymen Design, hoch definierten künstlerischen Entwürfen und individuell gestalteten Notprodukten, funktionalen, puristischen Objekten und „Kitsch", substantiell ehrlichen Objekten und Material- sowie Funktionssurrogaten, Markenwaren und no-name-Produkten, natürlichen und künstlichen Objekten. Reihen zur Material- und Form- und Funktionsgeschichte der Dinge im 20. Jahrhundert ergänzen dieses Ensemble.

Mehr Details unter: www.museumderdinge.de.

Findmittel:

Ver�ffentlichungen:
Eine Auswahl:
Kampf der Dinge. Der Deutsche Werkbund zwischen Anspruch und Alltag. Hg. Werkbundarchiv - Museum der Dinge. 2008.
Schnelldampfer, Landhäuser und Kaffee Hag. Der Deutsche Werkbund in Bremen, Delmenhorst und Oldenburg - 1900 bis 1948. Hg. WBA-MdD, Deutscher Werkbund Nord. 2004.
Thomas Hauffe: Fantasie und Härte. Das „Neue deutsche Design“ der 80er Jahre. Schriftenreihe des Werkbundarchivs Bd. 25. 1994.
Angelika Thiekötter: Kristallisationen, Splitterungen. Bruno Tauts Glashaus. 1993.
Wolfgang Dreßen: Nilpferd des höllischen Urwalds. Situationistische Internationale. Gruppe Spur. Kommune I. Schriftenreihe des Werkbundarchivs Bd. 24. 1992.
Claude Lichtenstein: Ferdinand Kramer. Der Charme des Systematischen. Schriftenreihe des Werkbundarchivs Bd. 23. 1991.
Blasse Dinge. Werkbund und Waren. 1945-1949. 1989.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Wilmersdorf Archiv

Name:
Wilmersdorf Archiv

Kurzname:

Tr�gereinrichtung:
Heimatmuseum Charlottenburg-Wilmersdorf

Strasse:
Schloßstr. 69

Postleitzahl:
14059

Ort:
Berlin

Postanschrift:

Telefon:
(030) 902913200

Telefax:

E-Mail:
heimatmuseum@charlottenburg-wilmersdorf.de

Homepage:

Leitung:
Elke von der Lieth, Brigitte Götz

Mitarbeiter(innen):
1

�ffnungszeiten:
Di 10.00-14.00, Do 14.00-18.00 und nach telefonischer Vereinbarung

Verkehrsverbindung:

Best�nde:
Dokumente zur Geschichte von Wilmersdorf mit den Stadtteilen Halensee, Grunewald, Schmargendorf und Wilmersdorf, historische Postkartensammlung und historische Fotografien, Fotosammlung Fechner, Industriefotografie, historischer Kartenbestand, Bibliotheksbestand von Zeitungen und Zeitschriften zur Bezirksgeschichte.

Findmittel:
Alphabetischer Katalog, Schlagwortkatalog, Fotodatei.

Ver�ffentlichungen:
Christoffel, Udo und Elke von der Lieth, Berlin Wilmersdorf in alten Bildern, in: Die Reihe Archivbilder, Sutton Verlag, Erfurt 2003.

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx

Zweites Deutsches Fernsehen (ZDF). Studioarchiv Hauptstadtstudio

Name:
Zweites Deutsches Fernsehen (ZDF). Studioarchiv Hauptstadtstudio

Kurzname:

Tr�gereinrichtung:

Strasse:
Unter den Linden 36-38

Postleitzahl:
10117

Ort:
Berlin

Postanschrift:
ZDF, Hauptstadtstudio Berlin, Studioarchiv, 10887 Berlin

Telefon:
(030) 20992540

Telefax:
(030) 20992544

E-Mail:
berlin-archiv@zdf.de

Homepage:
www.zdf.de

Leitung:
Karin Pantring

Mitarbeiter(innen):
8

�ffnungszeiten:
8.30-21.00

Verkehrsverbindung:
Unter den Linden (S)

Best�nde:
Das Studioarchiv steht vorrangig den in Berlin ansässigen ZDF- und 3sat-Redaktionen zur Verfügung. Hier werden Sendematerialien der Sendungen Aspekte, Morgenmagazin, Frontal 21, Kennzeichen D, Drüben u. a. archiviert. Über den Teilbereich Programmverwertung und -übernahme im ZDF-Sendezentrum in Mainz (Tel.: [06131] 70-9501) können Kopien und Kassetten von ZDF-Sendungen für nicht gewerbliche Zwecke angefordert werden; für die Verwertung von ZDF-Programmen ist die ZDF-Enterprises in Mainz-Hechtsheim zuständig (Tel. [06131] 991316). Anfragen zur wissenschaftlichen Nutzung von Beständen im Studioarchiv sind an den Leiter des Geschäftsfeldes Programmarchiv im ZDF-Sendezentrum Mainz (Tel.: [06131] 704700) zu richten.

Findmittel:

Ver�ffentlichungen:

Schlagw�rter:

Archivtyp:

Bild:

xxxxxx